[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55040.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   35->151 PF04138 * GtrA 2e-09 28.9 %
:HMM:PFM   35->151 PF04138 * GtrA 4.6e-26 27.2 114/117  
:BLT:SWISS 34->153 Y3818_MYCBO 1e-36 61.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55040.1 GT:GENE BAD55040.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 207772..208236 GB:FROM 207772 GB:TO 208236 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55040.1 LENGTH 154 SQ:AASEQ MHAEPPLPPTAELPLVDERLADADGAVDLKTQIIRFTVTGGFSAIVDFGLYVFLLKVVGLPVPVAKSIGFVAGTTTAYLINRRWTFQAPPSRARFLAVVALYATTFAVQVGINQLMVHLLGEDPVPVAVAFVVAQGTATVINFVVQRLVIFKID GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 34->153|Y3818_MYCBO|1e-36|61.7|120/121| TM:NTM 3 TM:REGION 47->69| TM:REGION 94->116| TM:REGION 127->149| SEG 3->15|aepplpptaelpl| SEG 124->134|pvpvavafvva| RP:PFM:NREP 1 RP:PFM:REP 35->151|PF04138|2e-09|28.9|114/116|GtrA| HM:PFM:NREP 1 HM:PFM:REP 35->151|PF04138|4.6e-26|27.2|114/117|GtrA| GO:PFM:NREP 3 GO:PFM GO:0000271|"GO:polysaccharide biosynthetic process"|PF04138|IPR007267| GO:PFM GO:0006810|"GO:transport"|PF04138|IPR007267| GO:PFM GO:0016021|"GO:integral to membrane"|PF04138|IPR007267| OP:NHOMO 40 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -----21111121111111-11111111111111111111-------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHEEEEEc //