[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55045.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:294 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  12->87 1adrA_ a.35.1.2 * 6.3e-07 22.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55045.1 GT:GENE BAD55045.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 213032..213916 GB:FROM 213032 GB:TO 213916 GB:DIRECTION + GB:PRODUCT putative DNA-binding protein GB:PROTEIN_ID BAD55045.1 LENGTH 294 SQ:AASEQ MALPQVTTGSTMPRRRLGRHLRDLRTRAKMTTRAAARHLEWSEAKIWRIETGQTSLRSLDVEAMCKIYGAPDEVVAPLAALAKETKARGWWTAYSDVIGEGFDIYIGLEEAARQLAGYENELVPGLLQTEAYARALLGAAHPDATATEIDRRVALRTRRQALLTRPGAPLRLDVVVAEAVLHKRIGGRAVAAEQLAHLRRMCELPTVRLRVVPAASDYHAGMATSRFAILEFPLGDVAQPEPPVVYVEAFTGPVYLDKDAEIERYRRAFASIAAVAVDARAPLDEAVAVLNRRS GT:EXON 1|1-294:0| SEG 14->37|rrrlgrhlrdlrtrakmttraaar| SEG 151->165|rrvalrtrrqalltr| SEG 266->281|rrafasiaavavdara| HM:SCP:REP 12->87|1adrA_|6.3e-07|22.4|76/0|a.35.1.2|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 177 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----6-------------------------------C----557----------------DH--H7NNKBB---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15, 293-294| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHccccHHHHHHHHcHHHcEEEEEEEccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEcccHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccEEEEEccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcc //