[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55046.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->131 3boqB PDBj 2e-07 33.0 %
:RPS:PDB   21->126 3bddA PDBj 6e-11 21.2 %
:RPS:SCOP  11->126 2fbiA1  a.4.5.28 * 5e-16 29.2 %
:HMM:SCOP  15->132 1jgsA_ a.4.5.28 * 1.2e-21 32.2 %
:RPS:PFM   57->105 PF01047 * MarR 3e-05 44.9 %
:HMM:PFM   65->105 PF01047 * MarR 2.5e-13 43.9 41/59  
:BLT:SWISS 43->130 YKOM_BACSU 3e-07 26.7 %
:PROS 79->114|PS01117|HTH_MARR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55046.1 GT:GENE BAD55046.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(213932..214336) GB:FROM 213932 GB:TO 214336 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55046.1 LENGTH 134 SQ:AASEQ MSKSTVDTARRPSASSALVGQWRDLLDRHAAVSCALEKALQNEHGIGLSEFETLDRLVDAACGKYRMSDLAGDIHLSQSALSRAVARLERDGLVERSMCEEDRRAIFVRMTDKGRAVYEAAMPTHRTVLADTWH GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 43->130|YKOM_BACSU|3e-07|26.7|86/154| PROS 79->114|PS01117|HTH_MARR_1|PDOC00861| BL:PDB:NREP 1 BL:PDB:REP 22->131|3boqB|2e-07|33.0|97/133| RP:PDB:NREP 1 RP:PDB:REP 21->126|3bddA|6e-11|21.2|104/138| RP:PFM:NREP 1 RP:PFM:REP 57->105|PF01047|3e-05|44.9|49/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 65->105|PF01047|2.5e-13|43.9|41/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 11->126|2fbiA1|5e-16|29.2|106/136|a.4.5.28| HM:SCP:REP 15->132|1jgsA_|1.2e-21|32.2|115/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 119 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- ---16-1-1121111------1---2-------3334433-213-21-111-2122-1---1223116651----------------------------------1-----------------------------------------------------------------------------------------------------------1----1---------------------------------1------------------------------------11111-11111---------------------------------------------------------------------------------------1-1--------------------------------1-------------------------1-------------------------------------------------------1------------------------------------------------------------------------------------------11-1--------------------------------------------111----11--1-------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 92.5 SQ:SECSTR ##########ccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEccccTTcEEEEEcHHHHHHHTTcccHHHHHcHHHTc DISOP:02AL 1-3| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHc //