[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55055.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:202 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   60->180 PF04138 * GtrA 4e-05 31.6 %
:HMM:PFM   60->185 PF04138 * GtrA 1.5e-27 31.9 116/117  
:BLT:SWISS 60->185 Y110_MYCLE 2e-05 28.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55055.1 GT:GENE BAD55055.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 223622..224230 GB:FROM 223622 GB:TO 224230 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55055.1 LENGTH 202 SQ:AASEQ MKGTPGRVHRWGTVAEVSYPEHPAAPAEKLAAASVPAPGDVRAPLSATLLGLLRKGGGPFLVVGVIGFLVDAGTYNLLVFWIDGGVMRHAPLPAKIISIALATVVTYFGNKWWTFGHKQSGNPVREYLLYALFNAIAIGLQLGCLGFSRYVLDLASPLADNISGTLIGQAVAMIFRYWAYDTFVFTGAAEAEAEQQAEATGR GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 60->185|Y110_MYCLE|2e-05|28.4|116/123| TM:NTM 4 TM:REGION 60->82| TM:REGION 90->112| TM:REGION 130->152| TM:REGION 164->186| SEG 20->38|pehpaapaeklaaasvpap| SEG 188->199|aaeaeaeqqaea| RP:PFM:NREP 1 RP:PFM:REP 60->180|PF04138|4e-05|31.6|114/116|GtrA| HM:PFM:NREP 1 HM:PFM:REP 60->185|PF04138|1.5e-27|31.9|116/117|GtrA| GO:PFM:NREP 3 GO:PFM GO:0000271|"GO:polysaccharide biosynthetic process"|PF04138|IPR007267| GO:PFM GO:0006810|"GO:transport"|PF04138|IPR007267| GO:PFM GO:0016021|"GO:integral to membrane"|PF04138|IPR007267| OP:NHOMO 36 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ------------------------------------32--111121111111111211--213-12---11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 23-32, 192-202| PSIPRED ccccccccccccccEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccHHHHHHHccc //