[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55060.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  898/915 : Eukaryota  170/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:283 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   47->232 2awoC PDBj 3e-20 31.9 %
:RPS:PDB   49->239 2dwoA PDBj 5e-30 9.6 %
:RPS:PDB   212->258 3dmdA PDBj 4e-04 4.3 %
:RPS:SCOP  49->230 1sgwA  c.37.1.12 * 4e-25 21.0 %
:HMM:SCOP  47->254 1g2912 c.37.1.12 * 2.2e-41 28.8 %
:RPS:PFM   74->180 PF00005 * ABC_tran 1e-06 34.9 %
:HMM:PFM   74->180 PF00005 * ABC_tran 4.7e-10 29.0 107/118  
:HMM:PFM   48->84 PF03193 * DUF258 7.7e-05 33.3 36/161  
:BLT:SWISS 13->232 RFBE_YEREN 5e-56 49.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55060.1 GT:GENE BAD55060.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(229485..230336) GB:FROM 229485 GB:TO 230336 GB:DIRECTION - GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD55060.1 LENGTH 283 SQ:AASEQ MSRVSIDTHQAWVEFPIFDAKSRSLKKAFLGKAGGAIGRNQSDVVVVEALRDINLSLREGDRIGLVGHNGAGKSTLLRLLSGIYEPSRGSARIRGRVAPVFDLGVGMDPEISGYENIIIRGLFLGQTRKQMMSKIDEIADFTELGEYLHMPLRTYSTGMRVRLAMGVVTSIDPEILLLDEGIGAVDAEFMKKARLRLQELVARSGILVFASHSNEFLAQLCDSALWIDHGQIRLRGGIEEVVRAYEGPDAGNHVATVLREMAAERAGRAEGSADERELEQNAT GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 13->232|RFBE_YEREN|5e-56|49.1|220/239| SEG 259->277|remaaeragraegsadere| BL:PDB:NREP 1 BL:PDB:REP 47->232|2awoC|3e-20|31.9|185/363| RP:PDB:NREP 2 RP:PDB:REP 49->239|2dwoA|5e-30|9.6|187/449| RP:PDB:REP 212->258|3dmdA|4e-04|4.3|47/310| RP:PFM:NREP 1 RP:PFM:REP 74->180|PF00005|1e-06|34.9|106/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 74->180|PF00005|4.7e-10|29.0|107/118|ABC_tran| HM:PFM:REP 48->84|PF03193|7.7e-05|33.3|36/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 49->230|1sgwA|4e-25|21.0|176/200|c.37.1.12| HM:SCP:REP 47->254|1g2912|2.2e-41|28.8|208/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 20985 OP:NHOMOORG 1136 OP:PATTERN GG83D98ABBBAA9CCS8B9AA6MOBEIGIICB699756A666GN9KMCCeVS3EKFFHB9A98I134 EHZAuGHMMMOHGAFDEBB-BJ33FeBBBBBBOQPQVibeDNBUGZJHJGGBPRXFBF55QSKBQTSgjkLGDCCKBAF5QGO52444998715228--69C88AI9F7D222222232233337B548A24B5G7NSSbZ99CTGOJTTMLLLPFFE9DBBAILHMTYUB6D6D534E5C73MGJ85MF2FUZiikhkjntVltkljofWZZOUomnNUVWVPSQSSPORtuIFFGFHFEFFGGFEFGJEBBWQJHURGAELKYXDDYYKICGILHKLMLMMLKQVTUSRQRRPRVQRSKJKKJKKKLKKJJZOOLILSRSLPcSejdddjheeQdOUUaaJIJKdRSNIiORI7ooOPNORHGKTKRLFDFFBNFGGF97778IE***CDQdaXYcbdZZcWeZXa*-LOeGGgKSm*F4************yl87DVZpYSYccPdDCDDDDDDP8A5BMEQ3211-11111--2211422232222122188A99ARtiVbecfeebdQPQNaam*UTRRMXee*XZfT47RSNOJOIMURlXtxDNA8EA9KD99A9AA9EB8FMLNKe9MDLHCFQHFK7IMJFHGMDEKLHMQUHP4CBC577778735354333439455A9ONVBIFD9F7NFFFGGCCEHGGGFJEBGHI--49B9A------ZWleJWOTVVSUTPTRU-USRTUSUUTSUTTTSSTTSemekhNOKRPNPNQOQRQNNQNPMYNLJRQMP71Xbddgeebbggg115556666DDBDF9YNYEDFKCH8A979BCEBABCCB7C477RJNMMNLWbeYVXSRNeegA675757868FIIVKLLLLVUOPPDDEBBBBAABAAAA22DCAA567923222121R5A63313-3221421111324443112BLMCDKMLLI6F8 ----CB4-4226CO71231245444344311115834423323112221321222222332221--------------------1-21-132222222221-3224-54788B9C6G7643496KN4P5Z*E3E6G8A53E54I87A541H42z58C8P7FQ4A7538AAP7BB56495q33256FBDV2GC26KDIG3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 275-276, 280-283| PSIPRED cccEEEEEEEEEEEEcccccHHHHHHHHHcccccEEEEEEEccEEEEEEEccccEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEEEEEEccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHEEEEEccEEEEEccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccc //