[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55061.1
DDBJ      :             putative ABC transporter membrane protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  145/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:294 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->255 PF01061 * ABC2_membrane 1.1e-21 17.5 200/208  
:BLT:SWISS 47->294 RFBD_YEREN 1e-32 26.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55061.1 GT:GENE BAD55061.1 GT:PRODUCT putative ABC transporter membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(230346..231230) GB:FROM 230346 GB:TO 231230 GB:DIRECTION - GB:PRODUCT putative ABC transporter membrane protein GB:PROTEIN_ID BAD55061.1 LENGTH 294 SQ:AASEQ MRSAEETPVNTATHVPSEPIVSDSQTFRRAFRDMRDGFGQRELWLSLGWQDIKQRYRRSVLGPFWITIATGVQAAAMGILYATLLGQPLREYLPYVTVGLIVWNVISASILEGSDVFIANEGLIKQLPSALSVHVYRLVWRQMLFFAHNLVIYLVLLAAFGVWENLGWSSLLALPAIGLIFLNSMWVSIVFGIFSTRYRDIAPILGSMTLMLFVLTPVMWTTKTLEDQIGTGSERARLVEIIPTFHYLEIVRAPLLGEPQALRHWVIVGAITVVGWIVAVFAMKQYRSRVPYWV GT:EXON 1|1-294:0| BL:SWS:NREP 1 BL:SWS:REP 47->294|RFBD_YEREN|1e-32|26.4|239/259| TM:NTM 6 TM:REGION 63->85| TM:REGION 92->114| TM:REGION 142->164| TM:REGION 171->193| TM:REGION 201->223| TM:REGION 256->278| HM:PFM:NREP 1 HM:PFM:REP 43->255|PF01061|1.1e-21|17.5|200/208|ABC2_membrane| OP:NHOMO 160 OP:NHOMOORG 146 OP:PATTERN -----------------------------------------------1-------------------- --2--11111111111111-11111111111111111111------------------------11111-------------------------------------------------------------------11111---2-----11-----------1--------------1------------1---------1---------111---------2-----------------------------1---------------------------------11---------------------------------------------------------------1---1--11----1----------1111-------2121-------11111111111-------------1-------------1-1----------22222222111211-------------------------------------1-----11-11-----111----------1-1----------1----1----1---------------------------------1-----1------1--1-----------------------1---1-------------------------------1------------1------------------------------------1-----1--1-1-11---1-----------1-----------------11111------------------------------------------1------------------------11111------1--------1111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 15-30| PSIPRED cccccccHHHHHHHcccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //