[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55062.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   56->201 PF10759 * DUF2587 4e-38 67.1 %
:HMM:PFM   40->204 PF10759 * DUF2587 3.5e-87 77.6 165/169  
:BLT:SWISS 58->178 Y115_MYCLE 3e-44 71.9 %
:PROS 1->20|PS00430|TONB_DEPENDENT_REC_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55062.1 GT:GENE BAD55062.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(231398..232012) GB:FROM 231398 GB:TO 232012 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55062.1 LENGTH 204 SQ:AASEQ MMGVMTHSEETPDSIVVVGPDGRPLVVPAEAGNHRTAPADAEDAAKGEADEREEQGESLADMVEQPAKVMRIGTMIKQLLEEVRAAPLDDASRSRLKEIHRSSVRELEQGLAPELRAELERLTLPFTDEAVPSDAELRVAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQMRQGALPAGVQIADPRVARGDQHHTGGSGQYL GT:EXON 1|1-204:0| BL:SWS:NREP 1 BL:SWS:REP 58->178|Y115_MYCLE|3e-44|71.9|121/174| PROS 1->20|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| SEG 37->54|apadaedaakgeaderee| SEG 111->125|lapelraelerltlp| RP:PFM:NREP 1 RP:PFM:REP 56->201|PF10759|4e-38|67.1|146/170|DUF2587| HM:PFM:NREP 1 HM:PFM:REP 40->204|PF10759|3.5e-87|77.6|165/169|DUF2587| OP:NHOMO 46 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- ---11---------11111-11111111111111111111111111------111--1--111-11-1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 40-60, 173-204| PSIPRED ccccccccccccccEEEEccccccccccHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc //