[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55070.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  124/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->227 3f67A PDBj 8e-13 31.3 %
:RPS:PDB   64->216 2cjpB PDBj 6e-10 15.0 %
:RPS:SCOP  46->227 1ve6A2  c.69.1.33 * 5e-14 21.0 %
:HMM:SCOP  35->257 1dinA_ c.69.1.9 * 8.1e-33 23.8 %
:RPS:PFM   84->227 PF00326 * Peptidase_S9 3e-12 36.1 %
:HMM:PFM   53->252 PF01738 * DLH 3.3e-18 29.2 192/217  
:BLT:SWISS 46->252 DLHH_YERPE 1e-13 27.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55070.1 GT:GENE BAD55070.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(239762..240535) GB:FROM 239762 GB:TO 240535 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55070.1 LENGTH 257 SQ:AASEQ MRVIHAQGQYLAKIGPAPYAGFMSGIYDDVAQLRGGAEDEERSGAGASVPVTVIEPEGHARGGIVVLHESREFTGSLLEFMRALSNEGWTVVAPNLFHRGEEAGQEVFGQDLFDDFDACFDWLTRRGVFPDCIGVLGFDHAGTAAFLVATNRPIGAAVSVAAPGITEPLTDQAEALVQAAPELQAPWLGLYGADDPETPPDDVEKLRDATARASVASLVVTYPGLRHRADDPSDDDDQNVLIDSQTRIFDWFDSNLR GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 46->252|DLHH_YERPE|1e-13|27.2|206/267| SEG 230->237|ddpsdddd| BL:PDB:NREP 1 BL:PDB:REP 48->227|3f67A|8e-13|31.3|179/237| RP:PDB:NREP 1 RP:PDB:REP 64->216|2cjpB|6e-10|15.0|153/319| RP:PFM:NREP 1 RP:PFM:REP 84->227|PF00326|3e-12|36.1|144/208|Peptidase_S9| HM:PFM:NREP 1 HM:PFM:REP 53->252|PF01738|3.3e-18|29.2|192/217|DLH| GO:PFM:NREP 2 GO:PFM GO:0006508|"GO:proteolysis"|PF00326|IPR001375| GO:PFM GO:0008236|"GO:serine-type peptidase activity"|PF00326|IPR001375| RP:SCP:NREP 1 RP:SCP:REP 46->227|1ve6A2|5e-14|21.0|181/260|c.69.1.33| HM:SCP:REP 35->257|1dinA_|8.1e-33|23.8|214/233|c.69.1.9|1/1|alpha/beta-Hydrolases| OP:NHOMO 130 OP:NHOMOORG 124 OP:PATTERN -------------------------------------------------------------------- ---1--------------------------------12221213--------------------111---------------------------------------------------------------------111---------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------1----------------------------------------1-1111-1111111111111-1111---1--1-----11------1------1--------------------------------------------------------------------------------------------------------------------1111-111111111111-111111111111111111111111---1111-1111111111111111-11--111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 99.6 SQ:SECSTR #ccEEEEccEEEEETGGGEEEEEEEcTTTccEEEEEEEEEEEEccccEEcccEEEcccccccEEEEEccTTccGGGGHHHHHHHHHTTcEEEEEccTTcTTccTTcGGGGcHHHHHHHHHHHHHHHcTTcccEEEEEETHHHHHHHHHHHHcGEEEEEEEccccccccTTccHHHHHHHcTTcHHHHTccTTHHHHHHTTTcHHHHHHHHHTcccccEEEEETTccccccTTHHHccHHHHHHHHHHHHHHHHHHcT DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEcccccEEEEEEEccccccccEEEEEEccccccHHHHHHHHHHHHcccEEEEEEcccccccHHHcccHHHHHHHHHHHHHHHHccccccccEEEEEEcHHHHHHHHHHcccccEEEEEEEccccccccccccccHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHcc //