[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55077.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.178.1
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->189 2h1tB PDBj 3e-09 25.0 %
:RPS:SCOP  41->189 2h1tA1  b.178.1.1 * 7e-07 26.5 %
:RPS:PFM   27->189 PF06475 * DUF1089 3e-14 36.5 %
:HMM:PFM   27->189 PF06475 * DUF1089 2.6e-52 47.1 157/162  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55077.1 GT:GENE BAD55077.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 245577..246146 GB:FROM 245577 GB:TO 246146 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55077.1 LENGTH 189 SQ:AASEQ MAPRWPAILTWRAHNASRMESVRVTLNGNRIRAAGRMIGGDCDEHPAFSASYDLVTDENGVTKRLSLRTTTAAGERHASIARDEEDYWLVDAGNSHVRSTFGGALDVDVVLSPFFNTLPIRRFGLQHAVDEVVVPVVYVRLPDLLVQEASLTYSSGADGISVLSPVSSATVTVDPDGFLLDYPGLAERI GT:EXON 1|1-189:0| SEG 129->146|vdevvvpvvyvrlpdllv| BL:PDB:NREP 1 BL:PDB:REP 48->189|2h1tB|3e-09|25.0|140/183| RP:PFM:NREP 1 RP:PFM:REP 27->189|PF06475|3e-14|36.5|159/162|DUF1089| HM:PFM:NREP 1 HM:PFM:REP 27->189|PF06475|2.6e-52|47.1|157/162|DUF1089| RP:SCP:NREP 1 RP:SCP:REP 41->189|2h1tA1|7e-07|26.5|147/186|b.178.1.1| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--1111111111111111------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 74.1 SQ:SECSTR ###############################################EEEEEEEEEcTTccEEEEEEEEEETTEEEEEEEEEcccccE##EETTccccGGGTTccEEEEETcGGGGHHHHHHHcccTTcEEEEEEEEEETTTTccEEEEEEEEEETTEEEEccccccEEEEEEcTTccEEEETTTEEcc DISOP:02AL 1-2| PSIPRED cccccEEEEEEEEcccccEEEEEEEEcccEEEEccEEEEEEccccccEEEEEEEEEcccccEEEEEEEEEEccccEEEEEEEcccccEEEEcccccccccccccEEEcEEEccccccccEEEEcccccccEEEEEEEEEEcccEEEEEccEEEEcccccEEEEcccEEEEEEEcccccEEEcHHHEEEc //