[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55079.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55079.1 GT:GENE BAD55079.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 247174..247713 GB:FROM 247174 GB:TO 247713 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55079.1 LENGTH 179 SQ:AASEQ MAAQRSGTNRATSEDYDDVEGFAVAVVREEGKWRCSPLSRAALTDLSAAEHELKALRSSGAVFGLLDVDDEFFIVLRPAPSGTRMLVSDATAAIDYDIAADVLDALNIEIPDIDPDELDDIEPWEEGDLGVLADLGLPEPVLSVILAETDLYPDEQLGMIAQRLGFANELSAVLDKLPR GT:EXON 1|1-179:0| SEG 89->106|dataaidydiaadvldal| SEG 108->126|ieipdidpdelddiepwee| OP:NHOMO 36 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- -----11111111-11111-11111111111111111111------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14| PSIPRED ccccccccccccHHHccccccEEEEEEEEccEEEEEEccHHHHccHHHHHHHHHHccccccEEEEEEEcccEEEEEEEccccEEEEEEccccccccHHHHHHHHHHccccccccccccccccccccccHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHccc //