[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55083.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:68 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  9->67 1j9iA_ a.6.1.5 * 3.9e-06 29.8 %
:RPS:PFM   9->57 PF05930 * Phage_AlpA 8e-04 38.8 %
:HMM:PFM   11->39 PF04539 * Sigma70_r3 6.2e-05 27.6 29/78  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55083.1 GT:GENE BAD55083.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 250159..250365 GB:FROM 250159 GB:TO 250365 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55083.1 LENGTH 68 SQ:AASEQ MDEMTDRRPLAEPKEIADFLGTSPAQLAQYRYLGKGPRFVKVGSRVRYRWADVEAWVEQNTRLSTGAA GT:EXON 1|1-68:0| RP:PFM:NREP 1 RP:PFM:REP 9->57|PF05930|8e-04|38.8|49/50|Phage_AlpA| HM:PFM:NREP 1 HM:PFM:REP 11->39|PF04539|6.2e-05|27.6|29/78|Sigma70_r3| HM:SCP:REP 9->67|1j9iA_|3.9e-06|29.8|57/68|a.6.1.5|1/1|Putative DNA-binding domain| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 64-68| PSIPRED ccccccHHccccHHHHHHHHcccHHHHHHHHHccccccEEEccHHHHHHHHHHHHHHHHHHHHHcccc //