[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55085.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->74 PF04402 * SIMPL 0.00013 38.3 47/207  
:HMM:PFM   5->36 PF12000 * DUF3495 0.00057 28.1 32/171  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55085.1 GT:GENE BAD55085.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 250829..251113 GB:FROM 250829 GB:TO 251113 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55085.1 LENGTH 94 SQ:AASEQ MRSPAISAALEDWKRGYSPTEFARRHFRGSFRNELEAELAHLLLRLESADELQAAELARQFAERVARLDAQLRRNLSGDRHPGDDQAAPIRRTA GT:EXON 1|1-94:0| COIL:NAA 10 COIL:NSEG 1 COIL:REGION 50->59| SEG 34->47|eleaelahlllrle| HM:PFM:NREP 2 HM:PFM:REP 27->74|PF04402|0.00013|38.3|47/207|SIMPL| HM:PFM:REP 5->36|PF12000|0.00057|28.1|32/171|DUF3495| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 75-86, 93-94| PSIPRED ccccHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc //