[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55086.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->72 PF07586 * HXXSHH 0.00049 34.4 32/302  
:HMM:PFM   71->112 PF09941 * DUF2173 0.00083 29.3 41/108  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55086.1 GT:GENE BAD55086.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 251117..251461 GB:FROM 251117 GB:TO 251461 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55086.1 LENGTH 114 SQ:AASEQ MTSERPTVLPRDMVGRSGRTHPMPDPIFITTPDGSLVGAMSAEQLRADAERLMLELAAAASAGDTTAVAKVAASWRQRLDPEHLGTVALTAAARMAVEMVAPMLAQLTKRRGEQ GT:EXON 1|1-114:0| SEG 45->69|lradaerlmlelaaaasagdttava| HM:PFM:NREP 2 HM:PFM:REP 34->72|PF07586|0.00049|34.4|32/302|HXXSHH| HM:PFM:REP 71->112|PF09941|0.00083|29.3|41/108|DUF2173| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 109-114| PSIPRED ccccccccccHHHHccccccccccccEEEEcccccEEHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //