[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55087.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.152.1c.37.1
:484 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   104->240 2zudB PDBj 1e-05 31.8 %
:RPS:PDB   94->277 3cmxA PDBj 6e-12 19.9 %
:RPS:SCOP  95->245 1n0wA  c.37.1.11 * 6e-06 20.7 %
:RPS:SCOP  287->387 2oyoA1  a.152.1.3 * 6e-04 19.8 %
:HMM:SCOP  94->293 1n0wA_ c.37.1.11 * 1.9e-19 28.4 %
:RPS:PFM   97->280 PF06745 * KaiC 1e-06 32.9 %
:BLT:SWISS 97->258 RADA_RICCN 5e-06 31.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55087.1 GT:GENE BAD55087.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 251458..252912 GB:FROM 251458 GB:TO 252912 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55087.1 LENGTH 484 SQ:AASEQ MTDTSAEEAPTGGLRGSCPRHPVLDPACLDCKVWYAERVHWLREEMAALSADLGPDEYAPPPEEYEPRSGRRLVVTRGSEVRTRRVRWVDPDWMPAGSLVLLAGREGLGKSTIAAEKSARVTRGELEGEWYGQPRNVLYLHTEDARDFTVAPRLRAAGADMDRVLFVDVHTELTNTGTLILPADILGLDQLVVDEEVSFIVLDAATSAMSSELSGKDDRQVRQFLEPLAQLAARRDCVVLGLCHFGKRDGADTGKLILGSIAWSQVARSVLSVAKDEDSGNLVVTNTKANLAPRTRSMEAVIESATVPTDDGVAEVGVLRWIGESDRDARDLLAGEADDDTNERTAAEAWLEDYLTEHGQTPAKTVKAEARKQGYSDATVKRAAKSIRVHYEIAGFPRTSVWSLKSAQSDQRTPMHEPTEPTEPTGRDQRKRGEPIGEQTQSAQAHVYEPTADPTATPPVVHTPGRKPGQWLGSGKPVASAGAN GT:EXON 1|1-484:0| BL:SWS:NREP 1 BL:SWS:REP 97->258|RADA_RICCN|5e-06|31.9|135/444| SEG 57->67|eyapppeeyep| SEG 417->425|epteptept| SEG 450->464|ptadptatppvvhtp| BL:PDB:NREP 1 BL:PDB:REP 104->240|2zudB|1e-05|31.8|132/297| RP:PDB:NREP 1 RP:PDB:REP 94->277|3cmxA|6e-12|19.9|171/1603| RP:PFM:NREP 1 RP:PFM:REP 97->280|PF06745|1e-06|32.9|158/202|KaiC| RP:SCP:NREP 2 RP:SCP:REP 95->245|1n0wA|6e-06|20.7|140/210|c.37.1.11| RP:SCP:REP 287->387|2oyoA1|6e-04|19.8|101/186|a.152.1.3| HM:SCP:REP 94->293|1n0wA_|1.9e-19|28.4|190/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ---1----------------------------1---11-1--------------------------1-----111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1---------------------------------------------------------------------------------------1------------------------------------------------------------11----------11----1-----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 55-80, 208-223, 247-259, 407-441, 479-484| PSIPRED ccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccEEcccccccccHHEEEEccEEcccEEEEEEccccccHHHHHHHHHHHHHccccccccccccccEEEEEccccHHHHHHHHHHHccccHHHHHccccHHHHccccccccHHHHHHHHHHHHHccccEEEEccHHHHcccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccHHHHHHHHHEEEEEEEccccccEEEEEEccccccccccEEEEEccccccccccccccccEEccccccccHHHHcccccHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccccccccHHHHccccccHHHcccccEEEcccccccccccEEEcccccccccccccccccccccc //