[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55088.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   83->98 PF02954 * HTH_8 0.00026 43.8 16/42  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55088.1 GT:GENE BAD55088.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 252912..253298 GB:FROM 252912 GB:TO 253298 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55088.1 LENGTH 128 SQ:AASEQ MSRTAATVVPPTTVAVRLRVEELHGARYCASELVRRFNDSGRPVPDWLRRLDSRLDLEIQTLMSDDGQQSSTDEPDSELVGTAEAAKILGLSARQVRRLAADLDGQRMGRELIFRRAAVTEYAAARKE GT:EXON 1|1-128:0| SEG 4->16|taatvvppttvav| SEG 46->57|dwlrrldsrldl| HM:PFM:NREP 1 HM:PFM:REP 83->98|PF02954|0.00026|43.8|16/42|HTH_8| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 63-78, 127-128| PSIPRED ccccccccccccEEEEEEHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccc //