[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55090.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->39 PF08681 * DUF1778 0.00016 31.4 35/80  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55090.1 GT:GENE BAD55090.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 253692..253877 GB:FROM 253692 GB:TO 253877 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55090.1 LENGTH 61 SQ:AASEQ MTDQEQAAADIASAYVAKLTPEQFASFVAATREPGESTPPPVLGKLPEQRPEDAYPTGWAV GT:EXON 1|1-61:0| HM:PFM:NREP 1 HM:PFM:REP 5->39|PF08681|0.00016|31.4|35/80|DUF1778| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED cccHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccccccc //