[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55093.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->61 3eucB PDBj 2e-05 45.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55093.1 GT:GENE BAD55093.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 254982..255254 GB:FROM 254982 GB:TO 255254 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55093.1 LENGTH 90 SQ:AASEQ MAHPSLPGGRRAWHLRPCVRIAPVFSAAAAQIAGLNGIPVRANVTADRSMLTGLLSEPVLLNVGALGLGTLVPRVHDHWCAAAQGRAIAR GT:EXON 1|1-90:0| BL:PDB:NREP 1 BL:PDB:REP 16->61|3eucB|2e-05|45.7|46/341| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 46 STR:RPRED 51.1 SQ:SECSTR ###############cTTcEEEEEcHHHHHHHTTcEEEEccTTccccHHHHHHHHHcccEE############################# DISOP:02AL 1-7, 89-90| PSIPRED cccccccccccEEEcccHHHHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHcccccccccc //