[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55095.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   58->82 PF09793 * AD 0.00055 20.0 25/90  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55095.1 GT:GENE BAD55095.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(255976..256410) GB:FROM 255976 GB:TO 256410 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55095.1 LENGTH 144 SQ:AASEQ MRNRLTCVVSLVSLVSHITGQVSDPCLFEPFLTGHCVALGPGRPPCRAIGVHAIGSRERSERVSALGARIFRDFHRTVHGVQQSGRSGHSRAMHGPVAPLAQLCSWANWPVAFALVSSSWASWASWAMHRPDWPGAVVVARLCG GT:EXON 1|1-144:0| SEG 8->16|vvslvslvs| SEG 117->127|ssswaswaswa| HM:PFM:NREP 1 HM:PFM:REP 58->82|PF09793|0.00055|20.0|25/90|AD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 81-93| PSIPRED cccHHHHHHHHHHHHHHHHcccccccEEcHHccccEEEEccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcc //