[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55096.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->79 PF02467 * Whib 7.8e-11 44.2 52/66  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55096.1 GT:GENE BAD55096.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 256557..256847 GB:FROM 256557 GB:TO 256847 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55096.1 LENGTH 96 SQ:AASEQ MSWPKVRELAADLADARLVGAACAGRAPLFDAEVPGEDDNGRRYRLDAAAQVCESCPVLAECNAVARELGRLAVGVWAGRGRHLPAPVGRPRDGAA GT:EXON 1|1-96:0| SEG 6->22|vrelaadladarlvgaa| HM:PFM:NREP 1 HM:PFM:REP 21->79|PF02467|7.8e-11|44.2|52/66|Whib| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 89-96| PSIPRED cccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccc //