[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55099.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   42->102 2ca9B PDBj 2e-05 27.3 %
:HMM:PFM   45->83 PF01402 * RHH_1 3.9e-05 43.8 32/39  
:BLT:SWISS 34->98 YME2_ASHGO 6e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55099.1 GT:GENE BAD55099.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(260281..260589) GB:FROM 260281 GB:TO 260589 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55099.1 LENGTH 102 SQ:AASEQ MRFTTRTTGLLAAPPPILVRAAARMHRAGTQARHARQGPRRTMIGVRLTDEQIEQLDWRANSEGLVTKAGEPNRSELIRIMIAYAEQNMPADWRPEGWRYVG GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 34->98|YME2_ASHGO|6e-04|33.3|63/100| RP:PDB:NREP 1 RP:PDB:REP 42->102|2ca9B|2e-05|27.3|55/139| HM:PFM:NREP 1 HM:PFM:REP 45->83|PF01402|3.9e-05|43.8|32/39|RHH_1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 55 STR:RPRED 53.9 SQ:SECSTR #########################################ccccccccHHHHHHHH######TTTGGGTcccHHHHHHHHHHHHHHHHHHHccTTcccEEE DISOP:02AL 1-3, 29-37| PSIPRED cccccccccEEEcccHHHHHHHHHHHHccHHHHHHHcccccEEEEEEEcHHHHHHHcccccccccEEEcccccHHHHHHHHHHHHHccccccccccccEEcc //