[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55104.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  232/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.49.1
:176 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  50->122 1f6vA  a.49.1.1 * 7e-09 21.9 %
:HMM:SCOP  5->156 1xd7A_ a.4.5.55 * 1.1e-24 34.7 %
:RPS:PFM   1->107 PF02082 * Rrf2 1e-08 48.2 %
:HMM:PFM   1->24 PF02082 * Rrf2 0.00039 33.3 24/83  
:HMM:PFM   49->107 PF02082 * Rrf2 1.2e-23 52.5 59/83  
:BLT:SWISS 1->169 Y1318_MYCBO 8e-29 48.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55104.1 GT:GENE BAD55104.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 268642..269172 GB:FROM 268642 GB:TO 269172 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55104.1 LENGTH 176 SQ:AASEQ MHITAKVDYAVRTLLEIARLTPAEITPATAGCVAEPGVRPDAGVAAPAKVKAETIAAAQQIPPKVLETVLSDLRRAELVTSRRGPDGGYRLARPAAQISVADVIRAIEGPLASVRGQRPEDVRYEGMAEPLQRVWIALRVNIRAVLENVSIEQIAADRLPEFVDALTADPGAWARR GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 1->169|Y1318_MYCBO|8e-29|48.3|145/161| RP:PFM:NREP 1 RP:PFM:REP 1->107|PF02082|1e-08|48.2|83/83|Rrf2| HM:PFM:NREP 2 HM:PFM:REP 1->24|PF02082|0.00039|33.3|24/83|Rrf2| HM:PFM:REP 49->107|PF02082|1.2e-23|52.5|59/83|Rrf2| RP:SCP:NREP 1 RP:SCP:REP 50->122|1f6vA|7e-09|21.9|64/91|a.49.1.1| HM:SCP:REP 5->156|1xd7A_|1.1e-24|34.7|124/127|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 280 OP:NHOMOORG 232 OP:PATTERN -------------------------------------------------------------------- --2-3----------1111-11--11111111111111111111----------------111----1--1-----------2-----------------------1-----------------------------1111----11---2--12211-------121221-------------11111---1111111111111111111211111111--1111------11-1111111-11111-11111-----------------------------------------------------------------------11------------1------------1--1-22111111-2111----1--2222-----23--1--------11111111112---2--2---21-2221221222221---1----1-----11111111----1-22------------------------------12-21-111-------1--------------------------11132121111--11-1-1----------11--------1--31----131-1111-1-11-1-1------------------------------1--1--1------------------------11---------------------------------------------------------------------------------------------1-----1111-----------------------------1--1111-----------------------------------------------------------------------------------------------------------12- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 168-176| PSIPRED cccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccc //