[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55109.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->135 PF09849 * DUF2076 9.5e-05 31.2 77/247  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55109.1 GT:GENE BAD55109.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 275042..275578 GB:FROM 275042 GB:TO 275578 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55109.1 LENGTH 178 SQ:AASEQ MTNPGDSDEWWKQYGGEGVSPDSGASSSVPQYPTSGPSGYPSAPQYPQQPPQYQQPQYQPPQPQYPQSSGPSYPQQPGYGYPQAGGYQPYGAPPSGGLNGMALASMIVSIAGVASCCFIVPSIVGLVLGVVAMNQMKTSGDYNGKGMAQAGIWVGAAGAVLGIVYWVLNIAIGFSAGM GT:EXON 1|1-178:0| TM:NTM 2 TM:REGION 106->128| TM:REGION 151->173| SEG 35->97|sgpsgypsapqypqqppqyqqpqyqppqpqypqssgpsypqqpgygypqaggyqpygappsgg| HM:PFM:NREP 1 HM:PFM:REP 48->135|PF09849|9.5e-05|31.2|77/247|DUF2076| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-113, 132-141| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccEEcccEEEcHHHHHHHHHHHHHHHHHHHcccc //