[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55110.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:239 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   105->231 PF06271 * RDD 4e-09 38.7 %
:HMM:PFM   101->232 PF06271 * RDD 9.3e-26 26.0 127/133  
:BLT:SWISS 105->228 YXAI_BACSU 7e-04 39.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55110.1 GT:GENE BAD55110.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(275643..276362) GB:FROM 275643 GB:TO 276362 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55110.1 LENGTH 239 SQ:AASEQ MTSGGYDPNQNPQGGQPYGQPYPQGGQPYGQQPFGKDPYGQQPPQYGQQPQYGEQPPYGQQPQYGQQPQYGEQQPYPQNPYGQQAYGGYGDPGLGGAQPGDLGSRIGARVIDHIIVSIPALIFSFVFANSSTGIGTQLVVSALLAFVPIGYFVLMETTQGFTLGKKLLGLRVLAPGGAPKIDPATSFKRNLYVITNLIPCVGWLVSIGLAIYIMITIEQDPNKQGWHDKFAGGTQVVKG GT:EXON 1|1-239:0| BL:SWS:NREP 1 BL:SWS:REP 105->228|YXAI_BACSU|7e-04|39.1|110/151| TM:NTM 3 TM:REGION 108->130| TM:REGION 134->156| TM:REGION 195->217| SEG 4->33|ggydpnqnpqggqpygqpypqggqpygqqp| SEG 38->103|pygqqppqygqqpqygeqppygqqpqygqqpqygeqqpypqnpygqqayggygdpglggaqpgdlg| RP:PFM:NREP 1 RP:PFM:REP 105->231|PF06271|4e-09|38.7|119/132|RDD| HM:PFM:NREP 1 HM:PFM:REP 101->232|PF06271|9.3e-26|26.0|127/133|RDD| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -----1-----1-------------1-------1111111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 7-105| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccEEEEcc //