[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55114.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   159->203 1rrvB PDBj 3e-04 35.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55114.1 GT:GENE BAD55114.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(280150..280797) GB:FROM 280150 GB:TO 280797 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55114.1 LENGTH 215 SQ:AASEQ MTQWLPVLSSLIVAGAALIGFAVNNRTNRRAIEAADERHRETLEEARRGMELAHTAGERREHDKWRHEAVVAAVSSVLETSNSVRQQLWSCHRWEVDDNFELERVGADIHEALWGCNGTINRLRLLASPKIPNQCEDLLSTLGAARNITLQYLKLQLDDEATSEEFTEINSLWEKAIRKAIEQERAVVNATRAELGIERLEDVAKPARQPVLDTA GT:EXON 1|1-215:0| SEG 69->77|avvaavssv| BL:PDB:NREP 1 BL:PDB:REP 159->203|1rrvB|3e-04|35.6|45/400| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 45 STR:RPRED 20.9 SQ:SECSTR ##############################################################################################################################################################cccccTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccH############ DISOP:02AL 37-43, 213-215| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //