[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55117.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->143 2b79A PDBj 8e-12 11.3 %
:RPS:SCOP  2->144 2il5A1  d.129.3.5 * 2e-17 12.6 %
:HMM:SCOP  1->145 1z94A1 d.129.3.5 * 9.5e-30 37.2 %
:RPS:PFM   3->140 PF10604 * Polyketide_cyc2 2e-06 36.1 %
:HMM:PFM   2->143 PF10604 * Polyketide_cyc2 1.5e-23 31.9 135/139  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55117.1 GT:GENE BAD55117.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(283748..284185) GB:FROM 283748 GB:TO 284185 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55117.1 LENGTH 145 SQ:AASEQ MQVDVRTEIVIDRPPSTVAAYAADPANVPRWYANIHEVRWVSEPPLRTGSQLEFAAQFLGRRLVYTYEVTEYVPGSLLVMRTARGPFPMETSYTWEPTAAGTRMTLRNRGEPAGFSRVLAPVLESAVRRANRADLARLKAELEAE GT:EXON 1|1-145:0| RP:PDB:NREP 1 RP:PDB:REP 5->143|2b79A|8e-12|11.3|133/142| RP:PFM:NREP 1 RP:PFM:REP 3->140|PF10604|2e-06|36.1|133/141|Polyketide_cyc2| HM:PFM:NREP 1 HM:PFM:REP 2->143|PF10604|1.5e-23|31.9|135/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 2->144|2il5A1|2e-17|12.6|143/162|d.129.3.5| HM:SCP:REP 1->145|1z94A1|9.5e-30|37.2|137/0|d.129.3.5|1/1|Bet v1-like| OP:NHOMO 11 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ------------------------------------11-2------------1---------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEEEcccHHHHHHHHHcGGGGGGTcTTEEEEEEccccTEcTTcEEEEEEEcETTcccEEEEEccccTTTEEEEEEEETTEEEEEEEEEEEcTTcEEEEEEEEEcccccTcTTHHHHHHHHHTTHHHHHHHHHHHHTcH DISOP:02AL 1-4, 143-145| PSIPRED cccccEEEEEEcccccEEEEEEccccccccccccEEEEcccccccccccccHHHHHHHcccEEEEEEEEEEEEccEEEEEEcccccccEEEEEEEccccccEEEEEccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHccc //