[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55118.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  418/915 : Eukaryota  66/199 : Viruses  0/175   --->[See Alignment]
c.66.1d.129.6
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->166 1xxlA PDBj 2e-10 35.0 %
:RPS:PDB   47->279 2aowA PDBj 2e-19 10.6 %
:RPS:SCOP  55->166 1xxlA  c.66.1.41 * 6e-21 33.0 %
:RPS:SCOP  138->238 2ooxA1  d.129.6.2 * 4e-05 8.5 %
:HMM:SCOP  14->281 1wznA1 c.66.1.43 * 1.2e-36 30.4 %
:RPS:PFM   45->166 PF01209 * Ubie_methyltran 3e-21 39.3 %
:HMM:PFM   66->163 PF08241 * Methyltransf_11 5.6e-25 42.6 94/95  
:HMM:PFM   216->252 PF04232 * SpoVS 0.00024 24.3 37/86  
:BLT:SWISS 25->278 YT37_STRFR 5e-25 32.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55118.1 GT:GENE BAD55118.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(284199..285047) GB:FROM 284199 GB:TO 285047 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55118.1 LENGTH 282 SQ:AASEQ MSSTTATPMDGHVRMDSYGLRPDRFDSAGQDQLVDVRDLQAALPGIQRLRTWAHQALAVRPGERAVDIGSGTGSEVFAFARAVGPTGEAVGVEPDPNLLAAAERRAGEQGVSAKFHSGDAYGIPFGADYFDAVLSERVFQHLTAPARAASEIARVLRPGGRTVVMDVDWDTAIIHPGDRRVVRQVVETLISATTNPLSGRRLPGLLTQAGLVIDEIGSHALIQDRAVGPGSLVDRISAMAVARGAISEKERDELLAGLERGARTGDIHLSVTMFAVLAHKPS GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 25->278|YT37_STRFR|5e-25|32.4|241/345| BL:PDB:NREP 1 BL:PDB:REP 60->166|1xxlA|2e-10|35.0|103/231| RP:PDB:NREP 1 RP:PDB:REP 47->279|2aowA|2e-19|10.6|227/288| RP:PFM:NREP 1 RP:PFM:REP 45->166|PF01209|3e-21|39.3|122/234|Ubie_methyltran| HM:PFM:NREP 2 HM:PFM:REP 66->163|PF08241|5.6e-25|42.6|94/95|Methyltransf_11| HM:PFM:REP 216->252|PF04232|0.00024|24.3|37/86|SpoVS| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01209|IPR004033| RP:SCP:NREP 2 RP:SCP:REP 55->166|1xxlA|6e-21|33.0|109/234|c.66.1.41| RP:SCP:REP 138->238|2ooxA1|4e-05|8.5|94/128|d.129.6.2| HM:SCP:REP 14->281|1wznA1|1.2e-36|30.4|214/0|c.66.1.43|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 739 OP:NHOMOORG 501 OP:PATTERN ------------------------3221-111-----------332151-B83------2-------- -24-4----------32----21111-----152324-45-213-21-111-111--1--622-1-3233------------1--1-------------------11-1---------------------2----1-113211111322411-1111-1-2-122-1311-------------11-11---3111111111111111111111-21111311---------2-1111111111111112---2--1-----1--1--------------111------------------------------------------12-------------------------4---1-1212---23-------2---11-------221211-1-11-------------11111---111-1111-11-11-1-2-1-11-----112--------2-----1---------------------------------11-111111111111222211122222221121121-111111111111311-1121-111-------131----2-1-1-114111---2122-----2211523---------------------------111111-11-1111111-1-111--1-1-----1113------12221111111111111-1112111111112111112222121121111111111111111211111211-111111111111--1111111-------11111-111----1111----------12112121111111111111111111111111---------------------------------------------------------------------------------22- ----111--------111-1552141211-----1-1--------1112111221-3-1212-21----3--2-1-------1121-1-5431111------1----13------------------------------------------------------------------1211N2-1111-----1-1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 100.0 SQ:SECSTR TTEEEEEccEEEEEEccccccGGGccccTTTcccHcHHHHHcTccGHTHHHHGGGccTTcccEEEEEEccTTHHHHHHHHHHHHTTHHcTTccEEEEEEcccHHHHHHHHHHHHTcHHHHHHHccccccEEEEEEEccGGGcccHHHHHHHHHTTEEEEEEEEEEEEccccHHHHHHHHHGGGccccTTcccEcccccHHHHHHHHHHHTccEEEEEEcGGGcTTccHHHHHHHHHTTcTTcGGGccHHHHHHHTcTTTEEEccccEEEEccEEEEEEEEcc DISOP:02AL 1-4| PSIPRED ccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEcc //