[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55119.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  109/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.45.1
:330 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   106->306 2oz5A PDBj 5e-11 31.1 %
:RPS:SCOP  71->309 1ywfA1  c.45.1.5 * 2e-09 21.6 %
:HMM:SCOP  73->329 1ywfA1 c.45.1.5 * 3e-50 31.1 %
:RPS:PFM   218->251 PF03162 * Y_phosphatase2 8e-04 44.1 %
:BLT:SWISS 112->309 Y669_RALEH 1e-13 30.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55119.1 GT:GENE BAD55119.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 285207..286199 GB:FROM 285207 GB:TO 286199 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55119.1 LENGTH 330 SQ:AASEQ MKFPHVALGRARLSGAACVVTLRYRLRPLTAQLGVVAVSAVALVGVLPTLTAPAQAGPLAPMLEAPGRDQRPLDLAHAPNARDIGGYPVRGGGKVRFGVVYRADALAELDGAEQQRLVDLGVQQVIDFRSPTEVAQAPDKLPAAIRRTEYPVYDANNDLYVLMSRLIAGGPQAQREALGDGKGVQYMSDYYRWLVTDASARGQFAAALRDIAGAPGAVLYHCTAGKDRTGWMTAILFSVLGVPDGQIYQDFLASNANLAAGNKALLDNLVAQGLVEDPELWEPILGVQREFLDAAFDQVRRSYGSMDEFLTAGLGLDTATLDALRSALVG GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 112->309|Y669_RALEH|1e-13|30.4|184/273| TM:NTM 1 TM:REGION 30->52| SEG 33->47|lgvvavsavalvgvl| SEG 89->102|vrgggkvrfgvvyr| SEG 252->269|lasnanlaagnkalldnl| SEG 310->324|ltaglgldtatldal| BL:PDB:NREP 1 BL:PDB:REP 106->306|2oz5A|5e-11|31.1|196/265| RP:PFM:NREP 1 RP:PFM:REP 218->251|PF03162|8e-04|44.1|34/155|Y_phosphatase2| RP:SCP:NREP 1 RP:SCP:REP 71->309|1ywfA1|2e-09|21.6|213/241|c.45.1.5| HM:SCP:REP 73->329|1ywfA1|3e-50|31.1|251/0|c.45.1.5|1/1|(Phosphotyrosine protein) phosphatases II| OP:NHOMO 155 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- ----1----------1--------1-------11112732-112-1-----1--------11-----112-----------1-----------1-----------1-1-------------------------------11-----------------------------------------------------11111-111111-11----1-1-1-------211111-2--------------------13431131333332222321--2-------------------------------------------------------------------------------------------------------1-------1-1----11-1---------------------------------------1----------------------------------------------------------1-----------1---------11------1-12111-1----11111-------------------------------2----1----------------------------------------------------------------------------------------------11---------------------------------11111--1----------------1----------------------------------------------------------------------1-1---1-1----------------------------------------------------------------------------------------------------- ------------------------------------1-----------1--------------------------------------------1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 60.0 SQ:SECSTR #########################################################################################################cTTccHHHHHHHHHTTccEEEEcccHHHHHHccccccTTccccccccHHHHHHHHHHHHHHHHccccHHHcHHHHH#HHHHHHHHHHHTTTTTHHHHHHHHHHHHHTTcc##EEEEccccccHHHHHHHHHHHHTTccHHHHHHHHHGGGGGHHHHHHHHHHHHHHHccTTcHHcccGGGcccHHHHHHHHHHHHHHHccH######################## DISOP:02AL 1-3, 60-61| PSIPRED cccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccccccccccccccccEEEcccccccHHcccEEcccccEEcccEEEcccccccccHHHHHHHHHccccEEEEcccHHHHHHcccccccccEEEEEEcccccccHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHcc //