[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55120.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:150 amino acids
:PSIPRED
:RPS:SCOP  59->149 1r9cA  d.32.1.2 * 3e-04 14.9 %
:HMM:SCOP  1->152 1r9cA_ d.32.1.2 * 5.8e-07 24.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55120.1 GT:GENE BAD55120.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(286408..286860) GB:FROM 286408 GB:TO 286860 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55120.1 LENGTH 150 SQ:AASEQ MAVNWTLTVDSRDAPVLADFWAAALGYQVEDPSPLIEQLLAAGHLPPDQVAEHRGGKIFRGYAAIRHPDDPFDPVSGIGRGRRLLFQDVPEHKSVKNRMHPDLDAGPEGRDAMVERLEGLGAERVREVDMGPAGHWWVMQDPEGNEFCVA GT:EXON 1|1-150:0| RP:SCP:NREP 1 RP:SCP:REP 59->149|1r9cA|3e-04|14.9|87/125|d.32.1.2| HM:SCP:REP 1->152|1r9cA_|5.8e-07|24.2|120/0|d.32.1.2|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 52 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ----2----------------2---1------31111222-1-1-4-1-11-111-11--213-3212231---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEEcccHHHHHHHHHHHHccEEcccccHHHHHHccccccHHHHHcccccccccccccccccccccccccccccccEEEEEEccccccccEEEEEEEEccccHHHHHHHHHHHcccEEEEEEcccccccEEEEEcccccccccc //