[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55121.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.96.1
:193 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   20->135 3cwsC PDBj 2e-06 20.0 %
:RPS:SCOP  8->170 1pu6A  a.96.1.5 * 9e-11 15.8 %
:HMM:SCOP  9->146 1mpgA1 a.96.1.3 * 4.4e-10 28.6 %
:HMM:PFM   27->190 PF00730 * HhH-GPD 1.7e-16 23.5 98/121  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55121.1 GT:GENE BAD55121.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 286941..287522 GB:FROM 286941 GB:TO 287522 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55121.1 LENGTH 193 SQ:AASEQ MTVTLCLAQEPEADKLLSEDPFALLTGMLLDQQYPLEHAFRGPRKIAERMDGFDIRRIAEADPQEFEELCATPPAIHRYGRSMARRTQDLARYVLEHYDGDTTRIWSEGDPDGATVLRRLEDLPGYGKQKARIFLALLGKQLGVRPKGWEKAAGDYAEPNSRRSAADITDGQSLLEVRAFKKQTKAQAKAAAG GT:EXON 1|1-193:0| SEG 179->192|afkkqtkaqakaaa| RP:PDB:NREP 1 RP:PDB:REP 20->135|3cwsC|2e-06|20.0|110/281| HM:PFM:NREP 1 HM:PFM:REP 27->190|PF00730|1.7e-16|23.5|98/121|HhH-GPD| RP:SCP:NREP 1 RP:SCP:REP 8->170|1pu6A|9e-11|15.8|152/217|a.96.1.5| HM:SCP:REP 9->146|1mpgA1|4.4e-10|28.6|119/183|a.96.1.3|1/1|DNA-glycosylase| OP:NHOMO 40 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ---11---------11111-11--11111111111111111111-1------111-------1-1-1111--------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 71.0 SQ:SECSTR ###############cccccHHHHHHHHHHTccccHHHHHHHHHHHHHHHcEEccccTTcEEcccHHHHHTccHHHTTccHHHHHHHHHHHHHHHHTcTTccccccccccHH##HHHHHHTTcTTccHHHHHHHHHHHHccccccccHHHHHHH####################################### DISOP:02AL 183-193| PSIPRED ccEEEEEcccccHHHHHcccHHHHHHHHHHcccccHHHHHccHHHHHHHHccccHHHHHHccHHHHHHHHccccccHHcccHHHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHcccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHccc //