[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55122.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:238 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55122.1 GT:GENE BAD55122.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 287633..288349 GB:FROM 287633 GB:TO 288349 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55122.1 LENGTH 238 SQ:AASEQ MRKSKLAVIAALVSIATGVAAGTAGAAPEAPAPEAVNFTAQSTDTQSIITTDAGSLVVEDEVFKIKASDGTVLAGTPLRFRIDDFEFPIAADISGRTATLTPQFDREHAVYKPVALPFEDKAPWKSEYDREVAAWTRLTNTISMGATIGTLVGGLGGAAVGCVLGGIAGATVASATIVGLFGPFIPAAAIGCLGGIIAVGALGTVAGQLLVTAPVAIAAAIQYFTTINQPFNAPAPAK GT:EXON 1|1-238:0| TM:NTM 4 TM:REGION 5->27| TM:REGION 147->169| TM:REGION 176->198| TM:REGION 204->226| SEG 16->36|atgvaagtagaapeapapeav| SEG 145->170|gatigtlvgglggaavgcvlggiaga| SEG 187->207|aaaigclggiiavgalgtvag| OP:NHOMO 5 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------5-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 235-238| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEccEEEEEEEccEEEEEccEEEEEEccccEEEEccEEEEEccEEcHHHccccccEEEEEEEccHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHHcccccccccccc //