[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55125.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  301/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.92.1
:307 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   158->250 3dwbA PDBj 8e-08 19.8 %
:RPS:SCOP  97->245 1eb6A  d.92.1.12 * 1e-05 10.3 %
:RPS:PFM   102->299 PF04228 * Zn_peptidase 8e-23 36.1 %
:HMM:PFM   101->299 PF04228 * Zn_peptidase 6.4e-27 33.8 195/292  
:BLT:SWISS 102->299 YPFJ_ECOLI 2e-20 35.1 %
:PROS 188->197|PS00142|ZINC_PROTEASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55125.1 GT:GENE BAD55125.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 291941..292864 GB:FROM 291941 GB:TO 292864 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55125.1 LENGTH 307 SQ:AASEQ MPPPMPYGPPGRAPMPPRKRGGGRVLALLLVVAVVIVGGLVRAAIRFDGSEHRATGPDPSFTYTPDGSPGVSETATNPLLTDPDATLLPADCDYAPWGTQVDTARRFFESAAACLEDAWQPVLAQVNLPFTPPALNVSATTAGISTPCTGSTTNFAAFYCPANKTIYLPISQLQTDLFKDNWVIYLSVFAHEYGHHVQAMSGILRKANSERVDAGTRSERGLELSRRIELQAQCFDGMYLGSAQDGGALTTAQIGLAVRDAGGRGDGPTDSPDHGSPDNSGAWFELGVEHNRTAQCNTFSAPAAAVG GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 102->299|YPFJ_ECOLI|2e-20|35.1|194/287| PROS 188->197|PS00142|ZINC_PROTEASE|PDOC00129| TM:NTM 1 TM:REGION 24->46| SEG 1->45|mpppmpygppgrapmpprkrgggrvlalllvvavvivgglvraai| SEG 78->91|plltdpdatllpad| RP:PDB:NREP 1 RP:PDB:REP 158->250|3dwbA|8e-08|19.8|91/660| RP:PFM:NREP 1 RP:PFM:REP 102->299|PF04228|8e-23|36.1|194/263|Zn_peptidase| HM:PFM:NREP 1 HM:PFM:REP 101->299|PF04228|6.4e-27|33.8|195/292|Zn_peptidase| RP:SCP:NREP 1 RP:SCP:REP 97->245|1eb6A|1e-05|10.3|126/177|d.92.1.12| OP:NHOMO 309 OP:NHOMOORG 301 OP:PATTERN -------------------------------------------------------------------- -11--11-111-11211----1---1------11113111-1-11111-1---1111-----1-321---3-----------------------------1111-111-1------------------1-----------------1------------------------------------111--------------------------------------1--------1---------------------------------------------11-1---1-------------1111111111111-11---1111--------------------------11----------------------1-11--1-----11111111-11111111111-111-1111111111--11111111111111-1--11-1----1------------1---------------------------------1111--1111111111-----11--------11-1111--1111111111111-1111--------------1111------1------------1------1--111--1---------------------1--1-----------1111---111--1-------11---------11---111111111111-1111111111111111111111----11111111111111111111-1111--111111111111------------------111111--------111111-1-1-1-11111111111111111-------------------1----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 45.3 SQ:SECSTR ################################################################################################HccccHHHHHHHHHHHHHHHHHHTcccccccEEEcccccccccTTcc#############EEEETTTTEEEEEGGGccTTTccTTccHHHHHHHHHHHHTTcTTGGGccTTccccccccHHHHH##HHHHHHHHHHHHHTTcccccccccTTTT######################################################### DISOP:02AL 1-7, 70-73, 209-223| PSIPRED ccccccccccccEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccEEEccccEEEEcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccccccccccc //