[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55132.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->143 1e09A PDBj 2e-09 15.8 %
:RPS:SCOP  4->143 2b79A1  d.129.3.9 * 1e-08 9.0 %
:HMM:SCOP  7->142 2d4rA1 d.129.3.6 * 2.4e-11 26.3 %
:HMM:PFM   3->143 PF10604 * Polyketide_cyc2 1.3e-17 28.0 132/139  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55132.1 GT:GENE BAD55132.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 305840..306274 GB:FROM 305840 GB:TO 306274 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55132.1 LENGTH 144 SQ:AASEQ MGQVSASSSITVAADPKRALEAIADYETVRPRILSAHYRDYKVVEGGKGAGTVAEWTLQATQKRARNVRAVVSVSDSIVTERDANSSLVNTWTVTPEGAGARVTLRTAWQGAGGVSGIFEGIFAPLGLKKIQAEVLENLKRELG GT:EXON 1|1-144:0| SEG 64->75|rarnvravvsvs| RP:PDB:NREP 1 RP:PDB:REP 2->143|1e09A|2e-09|15.8|139/159| HM:PFM:NREP 1 HM:PFM:REP 3->143|PF10604|1.3e-17|28.0|132/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 4->143|2b79A1|1e-08|9.0|134/137|d.129.3.9| HM:SCP:REP 7->142|2d4rA1|2.4e-11|26.3|133/0|d.129.3.6|1/1|Bet v1-like| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- --------------11111-11111111111111111111-1111--------------------1-111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 99.3 SQ:SECSTR ccEEEEEEEEEEcccHHHHHHHHTTTHHHHHHHcTTTEEEEEEEEccccTTcEEEEEEcEEEEEEEEETTTTEEEEEEcTTGGGEEEEEEEEEEcccTTccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHH# DISOP:02AL 1-5, 143-144| PSIPRED cccccccEEEEEEccHHHHHHHHHHHHccccccccHHcccEEEEEccccccEEEEEEEHHHHHHHHHHHHcccccccEEEEEcccccEEEEEEEcccccccEEEEEEEEcccccccHHHHHHcccHHHHHHHHHHHHHHHHHcc //