[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55133.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->112 3b59A PDBj 6e-09 15.7 %
:RPS:SCOP  8->115 1dhyA2  d.32.1.3 * 9e-09 14.8 %
:HMM:SCOP  1->115 1r9cA_ d.32.1.2 * 6.6e-15 26.3 %
:RPS:PFM   8->111 PF00903 * Glyoxalase 1e-04 32.7 %
:PROS 41->62|PS00107|PROTEIN_KINASE_ATP

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55133.1 GT:GENE BAD55133.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(306293..306640) GB:FROM 306293 GB:TO 306640 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55133.1 LENGTH 115 SQ:AASEQ MSLSIAAVTFDCTDAAKLAGFWSELLDRPVDPEANQYFASIGRGSGGQALMFIQVPDRTPGKNVIHLDLHADDRQAQVDRALALGAEHRGEFDEYGVRWTTLADPEGNLFDIAAE GT:EXON 1|1-115:0| PROS 41->62|PS00107|PROTEIN_KINASE_ATP|PDOC00100| RP:PDB:NREP 1 RP:PDB:REP 5->112|3b59A|6e-09|15.7|108/294| RP:PFM:NREP 1 RP:PFM:REP 8->111|PF00903|1e-04|32.7|104/120|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 8->115|1dhyA2|9e-09|14.8|108/146|d.32.1.3| HM:SCP:REP 1->115|1r9cA_|6.6e-15|26.3|114/0|d.32.1.2|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 58 OP:NHOMOORG 40 OP:PATTERN ---------------------------1---------------------------------------- ----2---------11111-12--111-111-32222123-1---1-1-11-1---2---111-3-1214-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEEEEccHHHHHHHHHHTTccEEEEEcccEEEEEcTTccccccEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHHTcccEEcccTTccEEEEEEcTTccEEEEEEc DISOP:02AL 115-116| PSIPRED cccEEEEEEEEcccHHHHHHHHHHHcccccccccccccEEccccccccEEEEEcccccccccccEEEEEEcccHHHHHHHHHHcccEEEEEcccccccEEEEEcccccEEEEEcc //