[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55134.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  192/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1d.60.1
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->125 1r8eA PDBj 1e-11 33.0 %
:RPS:PDB   6->268 3d71A PDBj 1e-33 16.9 %
:RPS:SCOP  6->109 1exiA1  a.6.1.3 * 2e-20 28.2 %
:RPS:SCOP  117->270 1jyhA  d.60.1.3 * 6e-13 13.6 %
:HMM:SCOP  5->113 1exjA1 a.6.1.3 * 2.6e-25 38.5 %
:HMM:SCOP  115->271 1jyhA_ d.60.1.3 * 5.3e-19 32.5 %
:RPS:PFM   6->44 PF00376 * MerR 2e-05 56.8 %
:RPS:PFM   194->268 PF06445 * AraC_E_bind 9e-08 41.1 %
:HMM:PFM   118->268 PF06445 * AraC_E_bind 8.2e-18 28.6 147/154  
:HMM:PFM   6->44 PF00376 * MerR 1.5e-15 50.0 38/38  
:HMM:PFM   49->108 PF09278 * MerR-DNA-bind 2.4e-10 36.7 60/65  
:BLT:SWISS 7->124 NOLA_BRASN 4e-14 41.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55134.1 GT:GENE BAD55134.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(306668..307483) GB:FROM 306668 GB:TO 307483 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55134.1 LENGTH 271 SQ:AASEQ MTATVTIGEFARLSHLSVKTLRYYHDIGLLAPAEVDRDTGYRRYGTDQVDRAHLIRRLRELDMPLPEIRAVLAASDTAARDATLRAHLARMEAELRRTAQVVASLRALLTPADPLPVEYRELPAVRALALREVVTKDDIDLWCAAAFPRLYAALAGVGVAPAGPAGATYALEFFAEDAGEVTAFVPVDPALALEPPHGLTMLDLPARHVAIAVHRGPFEDFDRTYGALGSHVAEHDRALPEPVREIYLVGPGDTPDPENYRTEVCWPVSRS GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 7->124|NOLA_BRASN|4e-14|41.2|114/237| SEG 144->170|aaafprlyaalagvgvapagpagatya| BL:PDB:NREP 1 BL:PDB:REP 6->125|1r8eA|1e-11|33.0|115/275| RP:PDB:NREP 1 RP:PDB:REP 6->268|3d71A|1e-33|16.9|261/277| RP:PFM:NREP 2 RP:PFM:REP 6->44|PF00376|2e-05|56.8|37/37|MerR| RP:PFM:REP 194->268|PF06445|9e-08|41.1|73/152|AraC_E_bind| HM:PFM:NREP 3 HM:PFM:REP 118->268|PF06445|8.2e-18|28.6|147/154|AraC_E_bind| HM:PFM:REP 6->44|PF00376|1.5e-15|50.0|38/38|MerR| HM:PFM:REP 49->108|PF09278|2.4e-10|36.7|60/65|MerR-DNA-bind| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 2 RP:SCP:REP 6->109|1exiA1|2e-20|28.2|103/118|a.6.1.3| RP:SCP:REP 117->270|1jyhA|6e-13|13.6|147/155|d.60.1.3| HM:SCP:REP 5->113|1exjA1|2.6e-25|38.5|109/118|a.6.1.3|1/1|Putative DNA-binding domain| HM:SCP:REP 115->271|1jyhA_|5.3e-19|32.5|151/155|d.60.1.3|1/1|Probable bacterial effector-binding domain| OP:NHOMO 291 OP:NHOMOORG 195 OP:PATTERN ---------------------------------------------111-------------------- ----4----------------1---1------223232-1-2-12-12--------2---33--423274-1--------2---------------------------------------------------------1-----4---11----1-----------2-1--------------121------1-22222323-2123221233-1222---3---11111-3--------------------11-1--------11-------1------------111------------------------1----------11--1111211-2--4------11--------23-------1-----1-------1----------1-21-1--------------111-1111-1--1--1--------1-----1-1111---111111111---1------------------------------------3111111122321-----1111--1--1211------1---1-22-----11-4----1------------1-----------------------1-11-1-1-------------------------------1-1---1---1111--1---2---1111------1-------1-1---------------------------------------------------------1-------------------------------211--1-----------------------------11-212------12-1-------------------------11--1-------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 98.9 SQ:SECSTR ##ccEEHHHHHHHHTccHHHHHHHHHTTcccccEEcTTTccEEEcTTGGGHHHHHHHHHHTTccHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccTTcEEEEEEccEEEEEEEcTTccTTTccGGGGHHHHHHHHHHHccccccEEEEEccccccEEEEEcccccccccccTTTcEEEEEccEEEEEEEEEccHHHHHHHHHHHHHHHHHTTccEEEEEEEEEEEccccTTccccEEEEEEEEEEc# DISOP:02AL 1-2| PSIPRED ccccccHHHHHHHHcccHHHHHHHHHHccccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccEEEEEEccccccccccccEEEEEEcccEEEEEEEEccHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHEEEEcc //