[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55135.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:192 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55135.1 GT:GENE BAD55135.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(307542..308120) GB:FROM 307542 GB:TO 308120 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55135.1 LENGTH 192 SQ:AASEQ MSANRLLFRGVLALALSLPALFLGAANAAADADVRTVAADYGGGCVLYPDNKAATLDSLRLRCSPEQQDAIFRDAPAGAVPTGVTNGWVVRPVYVQGIAPAFWVGKTFYTGPDGGFLMNRVTGAGLEAWRADVYRAPSLMDGEEAWALNYNPSPTPPLYDEIREVTPGVWLGYSWWRGFFQTTLLLTFALAN GT:EXON 1|1-192:0| TM:NTM 1 TM:REGION 7->29| SEG 12->40|lalalslpalflgaanaaadadvrtvaad| SEG 179->188|ffqttllltf| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccEEEEEccccccHHHHHHEEccHHHHHHHHHHcccccccccccccEEEEHHHHHHHHHHHHccEEEEEcccccEEEEEcccccHHHHHHHHHcccccccccEEEEEEEcccccccHHHHHEEEcccEEEEHEEcccccccEEEEEEEEcc //