[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55140.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.1d.110.2
:256 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  44->195 1mc0A2 d.110.2.1 * 2.5e-20 27.8 %
:HMM:SCOP  179->248 1qo0D_ c.23.1.3 * 3.3e-06 27.1 %
:HMM:PFM   199->247 PF03861 * ANTAR 2.5e-16 40.8 49/56  
:HMM:PFM   55->179 PF01590 * GAF 4.5e-09 20.8 125/154  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55140.1 GT:GENE BAD55140.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(312539..313309) GB:FROM 312539 GB:TO 313309 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55140.1 LENGTH 256 SQ:AASEQ MAPESRSAPVTGTIADAVQAQPAVDQLVAAFARMSGFFLTAGTAGTALKLITSLATEMVAPTSGAGISMLDGSGARMTAAATGEVVEEADSLQYQLGAGPCLTAWADRVVVRVDDFGTDQRWPEWSRRAARLGLASSLSAPLVAGTQALGAIKIYGARPGICGQREEHLLSMFSSQAAMLLAHMRAADDAERVSGLIAESLRGRDVINLAKGIIMARDRVDERGAFLILASTARNQNVPVRRVAERVAMSTVPRRR GT:EXON 1|1-256:0| SEG 15->30|adavqaqpavdqlvaa| SEG 78->89|taaatgevveea| SEG 107->115|drvvvrvdd| SEG 126->142|srraarlglasslsapl| HM:PFM:NREP 2 HM:PFM:REP 199->247|PF03861|2.5e-16|40.8|49/56|ANTAR| HM:PFM:REP 55->179|PF01590|4.5e-09|20.8|125/154|GAF| HM:SCP:REP 44->195|1mc0A2|2.5e-20|27.8|151/0|d.110.2.1|1/1|GAF domain-like| HM:SCP:REP 179->248|1qo0D_|3.3e-06|27.1|70/0|c.23.1.3|1/1|CheY-like| OP:NHOMO 24 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ---------------11----1---1------1-1-11-1----2--1----1-6-------1-1-111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-24, 186-204, 255-256| PSIPRED ccccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccEEEEEEEccccEEEcccccHHHHHHHHHHHcccccHHHHHHHcccEEEEcccccccccHHHHHHHHHcccEEEEEEEEEEcccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccccccc //