[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55144.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  211/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.72.2
:412 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   53->412 1e8cB PDBj 9e-19 14.5 %
:RPS:SCOP  45->255 1e8cA3  c.72.2.1 * 1e-14 23.2 %
:HMM:SCOP  43->274 2uagA3 c.72.2.1 * 1e-31 28.1 %
:RPS:PFM   58->176 PF08245 * Mur_ligase_M 3e-04 31.4 %
:RPS:PFM   301->399 PF08353 * DUF1727 3e-16 48.5 %
:HMM:PFM   301->400 PF08353 * DUF1727 1.5e-29 42.0 100/113  
:HMM:PFM   58->263 PF08245 * Mur_ligase_M 2.4e-18 29.4 180/188  
:BLT:SWISS 54->188 MURD_CAUSK 3e-06 30.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55144.1 GT:GENE BAD55144.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(315297..316535) GB:FROM 315297 GB:TO 316535 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55144.1 LENGTH 412 SQ:AASEQ MADFSIRGRIALRAAAAASWASRRAGRGNGSMIGGLIALKIDPTIMTQLGRGRRTVLITGTNGKSTTTRMTTAALGTLGAVATQADGANMDAGIVAALSRHPGVALAAIEVDELHLPHVSDALEPAAVVLLNLSRDQLDRVGEINMIERRLRAGLAKHPDTVVVANCDDVLMTSIAYDHPNVVWVAAGSGWAMDATSCPRSGEPIVWEGTHWRSTGADFERPQPDWWLEGEELVGPDGTRYPLHLALPGRANRGNAAQAVAAAVALGAEPAKAVVATGTVREIAGRYKTVQVGPHSARLLLAKNPAGWQEALSMIDHSASGLVIAVNGQVPDGEDLSWLWDVRFEHFEDVQVVAAGERATDLAVRLTYAGVAHTTVPDPLRAIASCPPGQVEVLANYTAFRDLNRDLEARRA GT:EXON 1|1-412:0| BL:SWS:NREP 1 BL:SWS:REP 54->188|MURD_CAUSK|3e-06|30.5|131/469| SEG 5->31|sirgrialraaaaaswasrragrgngs| SEG 66->85|tttrmttaalgtlgavatqa| SEG 256->274|aaqavaaavalgaepakav| RP:PDB:NREP 1 RP:PDB:REP 53->412|1e8cB|9e-19|14.5|337/484| RP:PFM:NREP 2 RP:PFM:REP 58->176|PF08245|3e-04|31.4|118/187|Mur_ligase_M| RP:PFM:REP 301->399|PF08353|3e-16|48.5|99/111|DUF1727| HM:PFM:NREP 2 HM:PFM:REP 301->400|PF08353|1.5e-29|42.0|100/113|DUF1727| HM:PFM:REP 58->263|PF08245|2.4e-18|29.4|180/188|Mur_ligase_M| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF08245|IPR013221| GO:PFM GO:0009058|"GO:biosynthetic process"|PF08245|IPR013221| RP:SCP:NREP 1 RP:SCP:REP 45->255|1e8cA3|1e-14|23.2|181/234|c.72.2.1| HM:SCP:REP 43->274|2uagA3|1e-31|28.1|196/204|c.72.2.1|1/1|MurD-like peptide ligases, catalytic domain| OP:NHOMO 212 OP:NHOMOORG 212 OP:PATTERN ---------------------------------1---------------------------------- ---1-11111111111-11-111111111111111111111111-----1--1111--1111-11-111111111111--111-----------------------------------------------------11111---11-11-111----------11--111------------------11-1-----------------------------------------11111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111--1111111111111-111111-111-1--11111111--111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 362 STR:RPRED 87.9 SQ:SECSTR ##################################################HcHHHHHHHHHTTccEEEcTTccEETTcccccccccccHHHHHHHHHHHHHHTTccEEEEccHHHHHTTTTTccccEEEEcccccccHHHHccHHHHHHHHHHHcccccccEEEEETTcHHHHHHHTTcTTcEEEcTccGGGccEEHHHHTTcEcEcccccTTTccEEEEEEEEEEccccEEEEEEETTccEEEEEcccHHHHHHHHHHHHHHHHTTccHHHHHHHGGGccccTTcEEEccTTccEEEEEccccHHHHHHHHHHHHHTcccEEEEEccccccccTHHHHHHHHHHHccEEcccccTccHHHHHHHHHTTccEEccHHHHHHHHHHccTTcEEEEcTTccEEEETcHHHHHHH DISOP:02AL 409-412| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHcccccEEEEEccHHHHHHHHHHccccEEEEEcccHHHHHHcccHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHccccEEEEEccccccEEEEEEcccccEEEEEccEEcccccccccccccEEEEcEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEEccEEEEEEEcccHHHHHHHHHHHHcccccEEEEEEcccccccccccEEccccHHHccEEEEEEEccHHHHHccHHHccccHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHccc //