[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55145.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  116/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   35->181 1ci0A PDBj 5e-20 8.5 %
:RPS:SCOP  38->182 1ci0A  b.45.1.1 * 8e-21 8.6 %
:HMM:SCOP  42->164 1flmA_ b.45.1.1 * 3.9e-20 27.6 %
:RPS:PFM   59->135 PF01243 * Pyridox_oxidase 3e-05 38.6 %
:HMM:PFM   46->136 PF01243 * Pyridox_oxidase 1.2e-18 31.0 84/89  
:HMM:PFM   156->216 PF05168 * HEPN 0.00058 23.7 59/117  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55145.1 GT:GENE BAD55145.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(316600..317265) GB:FROM 316600 GB:TO 317265 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55145.1 LENGTH 221 SQ:AASEQ MVRRRARCFNRTVTSTEITDPADLRALLGEVAPRVANKDRTALHPRDREWIATSPFLVMSTCDAEGRCDASPKGDPAGFVHVLDDHTLAIPERPGNRRADGYRNILSNPHVGLLFLIPGRPETLRINGRARLVRDAPYFDAMVVRGHRPVLAVEVAIEQIFFHCAKAFLRSHLWQPDQWPEDRLPSAACLVKEVQSGVTETLAELEEYYSPANYERKLYQS GT:EXON 1|1-221:0| RP:PDB:NREP 1 RP:PDB:REP 35->181|1ci0A|5e-20|8.5|141/205| RP:PFM:NREP 1 RP:PFM:REP 59->135|PF01243|3e-05|38.6|70/88|Pyridox_oxidase| HM:PFM:NREP 2 HM:PFM:REP 46->136|PF01243|1.2e-18|31.0|84/89|Pyridox_oxidase| HM:PFM:REP 156->216|PF05168|0.00058|23.7|59/117|HEPN| GO:PFM:NREP 1 GO:PFM GO:0010181|"GO:FMN binding"|PF01243|IPR011576| RP:SCP:NREP 1 RP:SCP:REP 38->182|1ci0A|8e-21|8.6|139/205|b.45.1.1| HM:SCP:REP 42->164|1flmA_|3.9e-20|27.6|116/122|b.45.1.1|1/1|FMN-binding split barrel| OP:NHOMO 142 OP:NHOMOORG 116 OP:PATTERN -------------------------------------------------------------------- ----1---------1------1---1------11112112------------1-------11--1-2-32--------------------------------------------------------------------------------------------------1----------------1--------11111111-111111------111-------------11-----------------------------------------------------------------------------------------------------------------------------------------------1111-------22211-2211-------------11111322-21-12211112311111----2-----111------------1--2-----------------------------------1111-------1-------1--------11112--11--1---2-1-1--1--111------------1-------------------------------1----------------------------------1---------------------------------------------------------------------------------1--------------------------1----------------------------2---------------------------------11-------11-------------------1---1------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 82.8 SQ:SECSTR ##############################cccHHHHHHHHHHHHHHccccccTTEEEEEEEETTGccTTEEEEEEEEccEEccccEEEEEEccccHHHHHHHHHHHccEEEEEEEETTTTEEEEEEEEEEEccHHHHHHHHHHccHHHHHHHHHccTTcccccHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHTcTTHHHHHHHHTTcccc######## DISOP:02AL 1-7, 220-221| PSIPRED ccccccHHccccccccEEEcHHHHHHHccccccHHHHHHcccccHHHHHHHHHccEEEEEEEcccccEEEEEccccccEEEEEcccEEEEEEcccccHHHHHHHHHccccEEEEEEEcccccEEEEEEEEEEEEcHHHHHHHccccccccEEEEEEEEEEEcccHHHHHHHcccccccccHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccc //