[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55146.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:566 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   222->340 2pb0B PDBj 4e-04 31.9 %
:RPS:PDB   38->525 3cnpA PDBj 3e-09 7.9 %
:RPS:SCOP  38->61 1f8rA1  c.3.1.2 * 1e-04 41.7 %
:RPS:SCOP  266->380 1d4cA2  c.3.1.4 * 2e-05 16.1 %
:HMM:SCOP  22->526 1o5wA1 c.3.1.2 * 2.5e-28 25.5 %
:RPS:PFM   462->556 PF03524 * CagX 8e-04 26.9 %
:HMM:PFM   263->524 PF01593 * Amino_oxidase 1.4e-06 19.9 221/449  
:HMM:PFM   24->58 PF01266 * DAO 1.5e-10 42.9 35/358  
:BLT:SWISS 218->284 ASTC_CITK8 4e-07 41.8 %
:BLT:SWISS 264->317 DADA_CHRVO 2e-04 49.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55146.1 GT:GENE BAD55146.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(317269..318969) GB:FROM 317269 GB:TO 318969 GB:DIRECTION - GB:PRODUCT putative oxidoreductase GB:PROTEIN_ID BAD55146.1 LENGTH 566 SQ:AASEQ MGAMTAGAAWGAGPALAAPAGKRVAVLGGGVAGLTAAHELAERGFEVTVYERRALGGKARSIPVPGTAAGGRPELPGEHGFRFFPGFYQHIPDTMRRIPFGANPDGVWNNLVAVPEARFARRDGDDFRVGLDLTAPPDPSAPGFAETLGAALATALKVSAAEGLFFANRLMVFNTSCDARRFGQWEHMAWLDFVRGHERSHEFRTLLSRTLTSIMVAAKDSLASVRTIGNMGEQFLGNPLGIGNDGALDRVLNGPTNLAWIDPWTQRLRALGVRFALGSEVRGLEVRDRRVTGARIVDETGAARTVEADHFVVALAAEQARALWSPEVLAVRPELEGMHRLVVDWMTGIQFYLRRTTDISPGHTAYIDSPWSLTSIGQNHLWARKLTEFGDGSVQDCLSVDISDWHTPGILYGKPAMECTHEEIAREVWAQLRAHLNDREELLRDADLHSWFLDPAIVWQADTGRNTNADPLLINTAGSWELRPEPHGDLENLYLAGDYVRTNVDLATMEGANESARAAVNALLDVTGSDAPRCRMYTLHRAAELEPLRRIDEDRYRAGLPNALDV GT:EXON 1|1-566:0| BL:SWS:NREP 2 BL:SWS:REP 218->284|ASTC_CITK8|4e-07|41.8|67/406| BL:SWS:REP 264->317|DADA_CHRVO|2e-04|49.0|49/435| SEG 2->37|gamtagaawgagpalaapagkrvavlgggvagltaa| SEG 117->128|arfarrdgddfr| SEG 145->161|aetlgaalatalkvsaa| BL:PDB:NREP 1 BL:PDB:REP 222->340|2pb0B|4e-04|31.9|113/387| RP:PDB:NREP 1 RP:PDB:REP 38->525|3cnpA|3e-09|7.9|454/493| RP:PFM:NREP 1 RP:PFM:REP 462->556|PF03524|8e-04|26.9|93/213|CagX| HM:PFM:NREP 2 HM:PFM:REP 263->524|PF01593|1.4e-06|19.9|221/449|Amino_oxidase| HM:PFM:REP 24->58|PF01266|1.5e-10|42.9|35/358|DAO| RP:SCP:NREP 2 RP:SCP:REP 38->61|1f8rA1|1e-04|41.7|24/370|c.3.1.2| RP:SCP:REP 266->380|1d4cA2|2e-05|16.1|112/322|c.3.1.4| HM:SCP:REP 22->526|1o5wA1|2.5e-28|25.5|306/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 29 OP:NHOMOORG 25 OP:PATTERN -------------------------11----------------------------------------- --1------------1111-1---1-11111--2222-------------------------------------------------------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 491 STR:RPRED 86.7 SQ:SECSTR #####################################HHHHTTcccEEEEccccccTTccEEEcGGTccGcEEEccccEGcEEEccccEEccTTTcHHHHHHHHHHHHHccccEEcccccccEEccccccEEEETccccccEEEETTTEEcTTcTTTcHHHHHHHHHHHHHHHHcccTTcccccHHHHHHHHHHHHGGGccHHHHHHHHHHGGGGHHHHTccTTTccHHHHccccccccEEEccHHHHHHHHHTTccGGGEETTcEEEEEETTTEEEEEETTccEEEEEEEEEcccHHHHcccccTTccEEEccccHHHHHHGGGcEEEccEEEEEEccccccccccEEEEcccccHHHHHHHHHcccHHHHHHHTTcccccTTcccEEEEEHHHHHcccEEEEEEccTHHHHHHHTTTcHHHHHHHHHHHHHHHHHHTTccccEEcccccccEEEEETTTcTTTcccEEEccTTccHHHHHHHHHTcccccEEEccGGGccTTcTTcHHHHHHHHHHHHHHHHHHHT###################################### DISOP:02AL 11-18| PSIPRED ccHHHHHHccccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHcccHHcccHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEccEEEEEEEEcccEEEEEEEccccccEEEEccEEEEEccHHHHHHHccccHHHHHHHHHHHHccccEEEEEEEEEEccccccccccEEEEcccccccccccHHHHccccccccccccEEEEEEcHHHHHHcccccccHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHEEEEEccEEEEEcccccEEcccccEEccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHcccccccccccccc //