[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55147.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  117/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:352 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  71->133 1s7bA  f.39.1.1 * 3e-07 12.7 %
:HMM:SCOP  37->142 1s7bA_ f.39.1.1 * 2.4e-10 32.4 %
:HMM:SCOP  189->299 1s7bA_ f.39.1.1 * 7.1e-11 30.5 %
:RPS:PFM   74->133 PF00892 * EamA 1e-04 37.3 %
:HMM:PFM   17->133 PF00892 * EamA 1.5e-15 31.0 116/126  
:HMM:PFM   156->291 PF00892 * EamA 1.3e-19 26.0 123/126  
:BLT:SWISS 67->303 EAMA_ECOLI 6e-28 30.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55147.1 GT:GENE BAD55147.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(319071..320129) GB:FROM 319071 GB:TO 320129 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55147.1 LENGTH 352 SQ:AASEQ MGRVTFRDRLLGLTVVLLWGLNFLAIRAGLDHFPPLFFAALRFVVPAVPVLLFVPRPRVPLRWLLLYGTGFGVLQFAFLFTAMREGMPTGLASLVLQSSAPFTVVLGALLLRERLAPRQLLGLAIATGGITVIGADRLEQAALLPLLLTLAAGLGWAFGNIGSRLAVASGPGVDPLHLTLWMTVVPPIPLFALSALTEGPGAGVRALAELASPTGPAALAGLAYIVVLGTVAGSGLWTYLMSRYPAGAVAPLSLLVPVVGIAAAWLVLDETPSGTELAGAVVVIAGAFLTTVGGRGTASTSAGIDEAPRGVPGRGSVPDDARRAGDVPATGVCASGTAAGSAGNAPGVIPTV GT:EXON 1|1-352:0| BL:SWS:NREP 1 BL:SWS:REP 67->303|EAMA_ECOLI|6e-28|30.9|233/299| TM:NTM 10 TM:REGION 9->31| TM:REGION 33->55| TM:REGION 62->84| TM:REGION 89->111| TM:REGION 114->136| TM:REGION 139->161| TM:REGION 177->199| TM:REGION 214->236| TM:REGION 247->269| TM:REGION 274->296| SEG 10->21|llgltvvllwgl| SEG 36->66|lffaalrfvvpavpvllfvprprvplrwlll| SEG 138->159|leqaallpllltlaaglgwafg| SEG 245->260|pagavaplsllvpvvg| SEG 329->347|atgvcasgtaagsagnapg| RP:PFM:NREP 1 RP:PFM:REP 74->133|PF00892|1e-04|37.3|59/125|EamA| HM:PFM:NREP 2 HM:PFM:REP 17->133|PF00892|1.5e-15|31.0|116/126|EamA| HM:PFM:REP 156->291|PF00892|1.3e-19|26.0|123/126|EamA| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF00892|IPR000620| RP:SCP:NREP 1 RP:SCP:REP 71->133|1s7bA|3e-07|12.7|63/106|f.39.1.1| HM:SCP:REP 37->142|1s7bA_|2.4e-10|32.4|105/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 189->299|1s7bA_|7.1e-11|30.5|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 119 OP:NHOMOORG 117 OP:PATTERN -------------------------------------------------------------------- ----1---------1---------------------1111------------111--1------121-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------111--------1-----------------------------1-----11---------1-----1----------------1-----1-----------------------------------------111111-111111111-111-11--111-1111---11--------------1------------------------------------------------------------------------1-1----------------------------------------11---1-1111111111-111111111111111111111111---1-1-111111-111-1---1111--------------------------------2-----------------------------------1111---1-------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 295-316| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccc //