[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55149.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:525 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   295->524 2afkG PDBj 1e-08 9.6 %
:RPS:SCOP  293->506 1cp2A  c.37.1.10 * 8e-10 12.3 %
:HMM:SCOP  267->506 1ionA_ c.37.1.10 * 2.5e-29 26.8 %
:RPS:PFM   395->475 PF06941 * NT5C 7e-04 25.9 %
:HMM:PFM   269->449 PF01656 * CbiA 5.1e-15 33.1 142/194  
:BLT:SWISS 321->384 DGOR_ECOLI 5e-04 50.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55149.1 GT:GENE BAD55149.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(321127..322704) GB:FROM 321127 GB:TO 322704 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55149.1 LENGTH 525 SQ:AASEQ MDTAEPSASSKAQDEHDPTDTAAEPGEQAESATAARTPEAGEPAPEPAAAGFAPPGFGPEGAGPAPDQFAPYGSGQFAQAGAPHPGGFAPPPPPQPGPPSAPYSEYRQEIGPDGMVRRVPQDGAEGVGPQSSTGEQPSYSWAPPPPPTAPMPPQQPPMYQQPGGAPDPGQPWPGGPQQYGQPPQQFGQPQPQFGQPPQPQYGQPHMPPGHSVNDLNLLKRARRAPRSGWRRAVHKASGGIINPGESAADIVYRDLVERVNQPVRGDYRIAILSLKGGVGKTTTTVGLGSTFASLRGDRVIAIDANPDLGTLAHRVPRQTRSTVRNLLEDQHISRYSDVRAHTSQAPSRLEVLASEQDPAVSEAFSEADYRKAIGILQSFYNIILTDCGTGLMHSAMAGVLDMASSLVLVTSPAIDGARSASATLDWLEHHGYGKLVERTVVVVNASRRGASTVDLDQLRKLFLDRTRAVQVVPFDDHLAEGAEIDLELVSKPTRRALLELAAMVADDFGYVGAQQYQQPGPMDRR GT:EXON 1|1-525:0| BL:SWS:NREP 1 BL:SWS:REP 321->384|DGOR_ECOLI|5e-04|50.0|60/100| SEG 32->66|ataartpeagepapepaaagfappgfgpegagpap| SEG 75->102|gqfaqagaphpggfapppppqpgppsap| SEG 136->209|qpsyswappppptapmppqqppmyqqpggapdpgqpwpggpqqygqppqqfgqpqpqfgqppqpqygqphmppg| SEG 220->232|rarraprsgwrra| SEG 273->290|slkggvgkttttvglgst| RP:PDB:NREP 1 RP:PDB:REP 295->524|2afkG|1e-08|9.6|228/272| RP:PFM:NREP 1 RP:PFM:REP 395->475|PF06941|7e-04|25.9|81/184|NT5C| HM:PFM:NREP 1 HM:PFM:REP 269->449|PF01656|5.1e-15|33.1|142/194|CbiA| GO:PFM:NREP 1 GO:PFM GO:0016791|"GO:phosphatase activity"|PF06941|IPR010708| RP:SCP:NREP 1 RP:SCP:REP 293->506|1cp2A|8e-10|12.3|212/269|c.37.1.10| HM:SCP:REP 267->506|1ionA_|2.5e-29|26.8|228/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 116 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- --------------44444-44223355555-34353332-1111-1--1-1111--1--221-1122113---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 234 STR:RPRED 44.6 SQ:SECSTR ##################################################################################################################################################################################################################################################################################################TccEHTccEEEEEEcccccccHHHHcccccccHHHHHHHHccTTTcccTTTcEEcGGGcEEEEcccTTcccHHHHHHHHHHHHHHHTTTEEEEEEccccccGGGGGGGcTTcccEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccTTHHHHHHHHHHHHTccEEEEEEEcccTHHHHHHHTTccHHTcHHHHHHHHHHHHHHTcccccccccccHHHHHHH# DISOP:02AL 1-261, 450-452, 509-525| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHcccccHHHHHHHHHccccccHHHHHHHHHccccccEEEcccccHHHHHHccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHccHHHHHccEEEEEcccccHHHHHHHHHHHHHHccccEEEEcccccHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccc //