[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55155.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  62/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:403 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->297 PF06772 * LtrA 5e-30 36.4 %
:HMM:PFM   18->386 PF06772 * LtrA 8.5e-51 30.5 338/354  
:BLT:SWISS 22->295 Y4337_RHIME 1e-26 32.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55155.1 GT:GENE BAD55155.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(330244..331455) GB:FROM 330244 GB:TO 331455 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55155.1 LENGTH 403 SQ:AASEQ MIGSKRARFQPVTEGASVTQLELFFDLVIVFAFTMVTDLASEETTAKNMLRALLVLAVMWWVWISYSWVGNVVRADEGLSRVAMFVAMGAAFIAALTIPEAFHDMPGGWFGPLVFAIAYLVARLVHLWVFWLASAEDAQLRGQVARWGLGSITIGTTLLVIAAMTHGVVQMALWLAAIVGDMLWTMVAGDDWRLNSAKHFAERYGLIIIVALGESIVSIGIGVAGLPISWPITVAAMLGLAVSGLLWWAYFDVASIAVEHELKTADGQRQIQIARNCYTYWHFPMIVGIIALSLGLKKVLYYVGDQSDHTLHDALYGIPLFALYGGVVLYLVALTGFKYYATREFSTQRVLTAVVLLALIPLAAALPALISLGLLAAVLMCLIGWEMVRFAEPRDQIRHANGA GT:EXON 1|1-403:0| BL:SWS:NREP 1 BL:SWS:REP 22->295|Y4337_RHIME|1e-26|32.2|255/409| TM:NTM 10 TM:REGION 18->40| TM:REGION 44->66| TM:REGION 79->101| TM:REGION 112->134| TM:REGION 160->182| TM:REGION 203->225| TM:REGION 235->257| TM:REGION 275->296| TM:REGION 315->337| TM:REGION 357->379| SEG 322->334|alyggvvlylval| SEG 351->377|ltavvllaliplaaalpalislgllaa| RP:PFM:NREP 1 RP:PFM:REP 18->297|PF06772|5e-30|36.4|264/339|LtrA| HM:PFM:NREP 1 HM:PFM:REP 18->386|PF06772|8.5e-51|30.5|338/354|LtrA| OP:NHOMO 70 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- ----2-------1-1----------1------1---1233-----1------211-----11----1-1-----------------------------------------------------------------------------1----------------------1-------------1-1---------------1-----------------------111111-1--------------------------------------------------------------------------------------------------------------------------------------------------------1-1111---1111----------1-------------111-11-111-1-1----------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------111111---1-------1-----------------------------------11----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17, 397-403| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccc //