[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55156.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->140 2d4rA PDBj 9e-07 19.7 %
:RPS:SCOP  10->142 1ln1A  d.129.3.2 * 2e-08 9.0 %
:HMM:SCOP  1->145 1t17A_ d.129.3.6 * 4.2e-15 29.8 %
:RPS:PFM   31->130 PF03566 * Peptidase_A21 2e-04 36.9 %
:HMM:PFM   9->140 PF10604 * Polyketide_cyc2 2.2e-09 22.2 126/139  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55156.1 GT:GENE BAD55156.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(331555..332010) GB:FROM 331555 GB:TO 332010 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55156.1 LENGTH 151 SQ:AASEQ MRTKTDIRFTVDAGPAHVLDVLAAIELLPEWSMYRDARVATRYENGRPRRVYVTADVLGSSDLQVLEYEWTDNRSSWQVVDSSRGIGGGGWFEVAEDPAGTRVWYHTELQSGLPLPGLLMKRTVQRWHETVAQNFVEFAESYPENEKFPSL GT:EXON 1|1-151:0| RP:PDB:NREP 1 RP:PDB:REP 7->140|2d4rA|9e-07|19.7|132/144| RP:PFM:NREP 1 RP:PFM:REP 31->130|PF03566|2e-04|36.9|84/647|Peptidase_A21| HM:PFM:NREP 1 HM:PFM:REP 9->140|PF10604|2.2e-09|22.2|126/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 10->142|1ln1A|2e-08|9.0|133/203|d.129.3.2| HM:SCP:REP 1->145|1t17A_|4.2e-15|29.8|141/0|d.129.3.6|1/1|Bet v1-like| OP:NHOMO 59 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------24422-23--3222222225551122----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 91.4 SQ:SECSTR ###EEEEEEEEcccHHHHHHHHHcHHHHGGGcTTEEEEEEEEEEETTEEEEEEEEEETEEEEEEEEEEEEETTTEEEEEEEEEcccEEEEEEEEEEccccEEEEEEEEEEcccTTTTTTTHHHHHHHHHHHHHHHHHHHHc########## DISOP:02AL 1-4, 83-90, 150-151| PSIPRED cccccccEEEEEccHHHHHHHHHHHHHccccHHHcEEEEEEEccccccEEEEEEEEEEEEEEEEEEEEEEccccEEEEEEccHHccccccEEEEEEccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //