[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55157.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->188 2qkoB PDBj 3e-37 53.3 %
:RPS:PDB   6->187 3ccyA PDBj 4e-14 7.8 %
:RPS:SCOP  7->70 1z77A1  a.4.1.9 * 1e-11 32.8 %
:HMM:SCOP  1->67 2gfnA1 a.4.1.9 * 1.5e-12 37.3 %
:HMM:SCOP  79->190 2gfnA2 a.121.1.1 * 2.1e-05 28.8 %
:HMM:PFM   11->56 PF00440 * TetR_N 5.5e-13 37.0 46/47  
:BLT:SWISS 5->155 BETI_RHIME 3e-08 29.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55157.1 GT:GENE BAD55157.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(332255..332827) GB:FROM 332255 GB:TO 332827 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55157.1 LENGTH 190 SQ:AASEQ MRTNPERRAALLDGAIEVLAEEGARGLTFRAVDKRAGVPAGTASNYFGNRDDLLTQVGSRFYERLQPSAEVMAQVSAGPRTRENIVSLMTETVARVSGFRTGFLAMLELRLEATRRPELRAVLTDRVRADLEFNVRNHLESGQPGDAETVELLYLALNWLILEHLTLPDIFDADRSAHLIETAVARLINS GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 5->155|BETI_RHIME|3e-08|29.7|148/203| BL:PDB:NREP 1 BL:PDB:REP 4->188|2qkoB|3e-37|53.3|167/173| RP:PDB:NREP 1 RP:PDB:REP 6->187|3ccyA|4e-14|7.8|179/186| HM:PFM:NREP 1 HM:PFM:REP 11->56|PF00440|5.5e-13|37.0|46/47|TetR_N| RP:SCP:NREP 1 RP:SCP:REP 7->70|1z77A1|1e-11|32.8|64/75|a.4.1.9| HM:SCP:REP 1->67|2gfnA1|1.5e-12|37.3|67/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 79->190|2gfnA2|2.1e-05|28.8|111/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 32 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- --------------11-----1--1------1----2122---1-1---1------------1-323122------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------1-----------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 100.0 SQ:SECSTR cccHHTTHHHHHHHHHHHHHHTcTTTccHHHHHHHTTccGGGGTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGcccHHHHHHHHHHHHHHHHHHHHHHHHcGGGTcHHHHHHHHHHHHHHGGGGTccTTccccHHHHHHHHHHHHHHcGHHT DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHc //