[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55158.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  78/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.71.1
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->161 2gd9A PDBj 2e-08 29.6 %
:RPS:PDB   1->181 2blcA PDBj 2e-19 14.9 %
:RPS:SCOP  1->190 1ai9A  c.71.1.1 * 9e-21 14.1 %
:HMM:SCOP  3->191 1ra9A_ c.71.1.1 * 6.4e-29 31.0 %
:RPS:PFM   75->118 PF02171 * Piwi 2e-04 41.5 %
:HMM:PFM   2->179 PF01872 * RibD_C 8.3e-13 26.0 154/200  
:BLT:SWISS 3->161 YWJB_BACSU 1e-15 37.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55158.1 GT:GENE BAD55158.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 332898..333470 GB:FROM 332898 GB:TO 333470 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55158.1 LENGTH 190 SQ:AASEQ MPKLVYYVGVSLDGYIAGPNGEIDFMPLGADFLDWMRADYPETLPAHARPHFGLDVDAPNRRFGSMIMGRATYEPGLAVGVASPYPHLTQYVVSTTLDSAPAPDVRVVRDPRALVRELKASDGPDIWLAGGGRLAATLRDEIDEMVVKHYPVVAGDGIPMFSGAFGPTRFTPVRRQGFANGTEVAVYRPA GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 3->161|YWJB_BACSU|1e-15|37.9|140/174| BL:PDB:NREP 1 BL:PDB:REP 3->161|2gd9A|2e-08|29.6|135/173| RP:PDB:NREP 1 RP:PDB:REP 1->181|2blcA|2e-19|14.9|175/215| RP:PFM:NREP 1 RP:PFM:REP 75->118|PF02171|2e-04|41.5|41/300|Piwi| HM:PFM:NREP 1 HM:PFM:REP 2->179|PF01872|8.3e-13|26.0|154/200|RibD_C| RP:SCP:NREP 1 RP:SCP:REP 1->190|1ai9A|9e-21|14.1|170/192|c.71.1.1| HM:SCP:REP 3->191|1ra9A_|6.4e-29|31.0|155/0|c.71.1.1|1/1|Dihydrofolate reductase-like| OP:NHOMO 92 OP:NHOMOORG 86 OP:PATTERN -------------------------------------------------11----------------- --1---------------------------------2111---1-2-1----111-----11--111-1------------------------------------21--1----------------------------------1-2--1-----11-------1----1-----------------------1-----1------1------11-------1-1-1111----------------------------------11----1-----------1-------------------------------------------------------------------------11---------------------1---------------------------------------1---11--------1------1------1--------------1----------------------------------1---------------------------------------------1-----------------------------------------------2---1-1-12-----------------------------------------1111--1---1--1-1-1--------------------------------------------------------1------------------------------------------------------1---------------------------------1---1------------------111--------111------------------------------------------------------------------------- --------------------------1-------------------------1111------------------------------------------------------------------------------------------------------------------------1---------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 100.0 SQ:SECSTR ccTTccTTccccEEEEEEcTTcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccEEEEEEHHHHHHcHccGGGcccTTEEEEEEcccccTTcccccEEEccHHHHHHHHHTcccccEEEcccHHHHHHHTTcccEEEEEEEEEEEccccEEcEccccGGGEEEEEEcccEEEHTTcccccc DISOP:02AL 190-191| PSIPRED ccEEEEEEEEEEEEEEEcccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHccccEEEEccccccHHHccccccccccccEEEEcccccccccccEEEEccHHHHHHHHHHccccEEEEEcHHHHHHHHHHHccEEEEEEEEEEEcccccccccccccccEEEEEEEEccccEEEEEEEcc //