[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55159.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.273.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->137 1ve0A PDBj 3e-06 26.0 %
:BLT:PDB   109->150 2p6hA PDBj 5e-04 45.0 %
:RPS:PDB   24->150 2cu5C PDBj 5e-13 19.7 %
:RPS:SCOP  16->150 1vphA  d.273.1.1 * 2e-20 23.9 %
:HMM:SCOP  16->152 1vphA_ d.273.1.1 * 5.3e-31 33.1 %
:RPS:PFM   36->135 PF01894 * UPF0047 2e-06 30.0 %
:HMM:PFM   35->149 PF01894 * UPF0047 3.3e-29 36.0 114/118  
:BLT:SWISS 23->152 Y2586_MYCBO 2e-21 42.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55159.1 GT:GENE BAD55159.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(333467..333925) GB:FROM 333467 GB:TO 333925 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55159.1 LENGTH 152 SQ:AASEQ MIDSRAVADTRCRDEHGAMESIVIDVHTGRTEVVHDLTPQCAKFVADLGDGLLHVFVPHATAGIAIMELGARSDDDLLAALRDLLPADDRWRHAHGSRGHGRSHVMPAMIAPYATVPVLDGELALGTWQSIALVDLNIDNPDRQVRLSFLAG GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 23->152|Y2586_MYCBO|2e-21|42.6|129/129| SEG 69->104|lgarsdddllaalrdllpaddrwrhahgsrghgrsh| BL:PDB:NREP 2 BL:PDB:REP 36->137|1ve0A|3e-06|26.0|100/131| BL:PDB:REP 109->150|2p6hA|5e-04|45.0|40/134| RP:PDB:NREP 1 RP:PDB:REP 24->150|2cu5C|5e-13|19.7|122/126| RP:PFM:NREP 1 RP:PFM:REP 36->135|PF01894|2e-06|30.0|100/120|UPF0047| HM:PFM:NREP 1 HM:PFM:REP 35->149|PF01894|3.3e-29|36.0|114/118|UPF0047| RP:SCP:NREP 1 RP:SCP:REP 16->150|1vphA|2e-20|23.9|134/138|d.273.1.1| HM:SCP:REP 16->152|1vphA_|5.3e-31|33.1|136/0|d.273.1.1|1/1|YjbQ-like| OP:NHOMO 36 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- ---------------1111-11--1111111111111-111111---1------------111-1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 83.6 SQ:SECSTR #######################EEEEccccEEEEEcHHHHHTTcTTcccEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHcccccTTcccTTccHHHHHHHHHHccEEEEEEETTEEcccTTcEEEEEEccccccEEEEEEEEc## DISOP:02AL 1-4| PSIPRED ccccccccccccccccccEEEEEEEEEEcccEEEEEcHHHHHHHHHHcccEEEEEEEccccEEEEEEEcccHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHccEEEEEEEccEEccccEEEEEEEEEcccccccEEEEEEEcc //