[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55161.1
DDBJ      :             putative aspartate-semialdehyde dehydrogenase
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  822/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:344 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->341 2qz9B PDBj 1e-63 45.8 %
:RPS:PDB   18->340 1brmB PDBj 1e-37 22.5 %
:RPS:SCOP  18->156 2gyyA1  c.2.1.3 * 7e-33 39.8 %
:RPS:SCOP  128->328 1brmA2  d.81.1.1 * 9e-61 31.6 %
:HMM:SCOP  2->155 2g17A1 c.2.1.3 * 1.6e-49 50.7 %
:HMM:SCOP  128->328 1mb4A2 d.81.1.1 * 3.7e-68 52.3 %
:RPS:PFM   18->114 PF01118 * Semialdhyde_dh 3e-09 42.6 %
:RPS:PFM   138->327 PF02774 * Semialdhyde_dhC 8e-28 50.9 %
:HMM:PFM   138->327 PF02774 * Semialdhyde_dhC 2.1e-54 46.6 176/184  
:HMM:PFM   4->118 PF01118 * Semialdhyde_dh 2.1e-32 41.2 114/121  
:BLT:SWISS 18->340 DHAS_MYCSM e-149 81.4 %
:PROS 242->256|PS01103|ASD
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55161.1 GT:GENE BAD55161.1 GT:PRODUCT putative aspartate-semialdehyde dehydrogenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 335304..336338 GB:FROM 335304 GB:TO 336338 GB:DIRECTION + GB:PRODUCT putative aspartate-semialdehyde dehydrogenase GB:PROTEIN_ID BAD55161.1 LENGTH 344 SQ:AASEQ MGVRVGVVGATGQVGAVMRKLLEERNFPADEVRFFASARSAGKKLPWRGGEIVVEDTETADPTGLDIALFSAGATMSRVQAPRFAAAGVTVIDNSSAWRKDPEVPLVVSEVNPEQTRNLVKGIIANPNCTTMAAMPVLKPLHDAAGLQRLIVSSYQAVSGSGLAGVEELASQVRAVVDDAEKLVHDGGAVEFPAPNKYVAPIAFDVIPLAGSLVDDGSGETDEDQKLRNESRKILGLPDLAVSGTCVRVPVFTGHSLSINAEFAEPLSVERAEELLGKAPGVKLVDVPTPLQAAGIDESLVGRIRQDPGVPDGRGLALFVSGDNLRKGAALNTIQIAEVLLSQR GT:EXON 1|1-344:0| BL:SWS:NREP 1 BL:SWS:REP 18->340|DHAS_MYCSM|e-149|81.4|323/346| PROS 242->256|PS01103|ASD|PDOC00847| SEG 2->17|gvrvgvvgatgqvgav| BL:PDB:NREP 1 BL:PDB:REP 18->341|2qz9B|1e-63|45.8|306/335| RP:PDB:NREP 1 RP:PDB:REP 18->340|1brmB|1e-37|22.5|320/357| RP:PFM:NREP 2 RP:PFM:REP 18->114|PF01118|3e-09|42.6|94/120|Semialdhyde_dh| RP:PFM:REP 138->327|PF02774|8e-28|50.9|159/165|Semialdhyde_dhC| HM:PFM:NREP 2 HM:PFM:REP 138->327|PF02774|2.1e-54|46.6|176/184|Semialdhyde_dhC| HM:PFM:REP 4->118|PF01118|2.1e-32|41.2|114/121|Semialdhyde_dh| GO:PFM:NREP 8 GO:PFM GO:0005737|"GO:cytoplasm"|PF01118|IPR000534| GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01118|IPR000534| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF01118|IPR000534| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01118|IPR000534| GO:PFM GO:0005737|"GO:cytoplasm"|PF02774|IPR012280| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF02774|IPR012280| GO:PFM GO:0016620|"GO:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor"|PF02774|IPR012280| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF02774|IPR012280| RP:SCP:NREP 2 RP:SCP:REP 18->156|2gyyA1|7e-33|39.8|133/150|c.2.1.3| RP:SCP:REP 128->328|1brmA2|9e-61|31.6|193/210|d.81.1.1| HM:SCP:REP 2->155|2g17A1|1.6e-49|50.7|152/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 128->328|1mb4A2|3.7e-68|52.3|197/222|d.81.1.1|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 1126 OP:NHOMOORG 938 OP:PATTERN 11-1--1211111111-11111111111111111111111111-1111-111111-11--2---1-11 1111211111111111111-11111111111111111111121111111111111-111122111112221-11111111111111111111111111111111111111--------------111111111111111111111111111111111111111111111111111111111111111111111122222222122222211111122211111111111111-1111111111111111111111-1111111-121111--1111111111111111111111111111-------------1111111111111-11111111111-1111111-11-11--11111111121111111-1111222111111112221111111111111111111-111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111----11111111111111111111-111111111111111111111111111111122111111111111111111111111111122212121211211112111111111111111111111111111221211111221111111111111111111---1111-1-11122222222222222222-2222222222222222222333222222222222222222222222222221-222222222222-1211111111111211111111111111111111111111112122222222222222222111--1111122222222222222111111111111111111111111----------1-------------------------1111111111111 ------1-------1-------1-----------------------11--------------1111-11-1111111-111111111--121-1-1--1----111--1-------------------------------------------------1--------------1--111E212111113-111121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 326 STR:RPRED 94.8 SQ:SECSTR #################HHHHHHTTGGGGcEEEEEEcccTTcccccTTccccccEETHHHHTccEEEEcccHHHHHHHHHHHHTTTcccEEEEcccTTTTcTTEEEEcHHHHHHHHHHHHHTTEEEccHHHHHHHHHHHHHHTTTcEEEEEEEEEEcGGGTcHHHHHHHHHHHHHHHHTTHHHHHcccccHHHHHHHHHHHHHHcccccTTTcccTccccccccTTcHHHHHHHTTcccccEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHcTTccccHccHHHHTTcccccEEEEEEcTTTTcTTEEEEEEEEETTcccccHHHHHHHHHHHHH# DISOP:02AL 344-345| PSIPRED ccEEEEEEccccHHHHHHHHHHHHcccccEEEEEEEccccccEEEEEcccEEEEccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEccccccccccccEEEccccHHHHHHHHccEEEcccHHHHHHHHHHHHHHHHccEEEEEEEEEccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHccccEEEcccccHHHccccccccccEEEEcccccccEEEEEEEEEcccHHHHHHHHHHHHHHHHcc //