[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55162.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->77 PF07116 * DUF1372 0.00029 28.3 60/104  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55162.1 GT:GENE BAD55162.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 336391..336633 GB:FROM 336391 GB:TO 336633 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55162.1 LENGTH 80 SQ:AASEQ MSGVGILRRCHQGVQMRKILARITAVAAFTGVVSLGSTGSASAITEEQCVNEGGGIVIYEMDGTKTCLGGFYTGQQILFS GT:EXON 1|1-80:0| HM:PFM:NREP 1 HM:PFM:REP 18->77|PF07116|0.00029|28.3|60/104|DUF1372| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccEEEEEEcccccHHcccccccEEEcc //