[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55167.1
DDBJ      :             putative ferric uptake regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->95 1mzbA PDBj 3e-08 35.7 %
:RPS:PDB   16->83 1dpuA PDBj 7e-05 13.4 %
:RPS:SCOP  7->136 1mzbA  a.4.5.42 * 3e-15 23.8 %
:HMM:SCOP  6->137 1mzbA_ a.4.5.42 * 1e-31 37.9 %
:RPS:PFM   15->122 PF01475 * FUR 1e-12 33.3 %
:HMM:PFM   15->123 PF01475 * FUR 1.9e-20 26.6 109/120  
:BLT:SWISS 10->138 FUR_MYCTU 8e-42 57.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55167.1 GT:GENE BAD55167.1 GT:PRODUCT putative ferric uptake regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 340796..341227 GB:FROM 340796 GB:TO 341227 GB:DIRECTION + GB:PRODUCT putative ferric uptake regulator GB:PROTEIN_ID BAD55167.1 LENGTH 143 SQ:AASEQ MHTETAEPRDRLRAAGLRVTAPRLAVLKAVSAHPHADADTIAAEVRAALGSVSTQGIYDVLHACVGAGLLRRIEPAGSPARYETRTGDNHHHLVCRRCGAVADVDCAVGAAPCLEPSETHGYAVDEAEVVFWGLCPDCRAAQD GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 10->138|FUR_MYCTU|8e-42|57.4|129/147| SEG 98->111|cgavadvdcavgaa| BL:PDB:NREP 1 BL:PDB:REP 12->95|1mzbA|3e-08|35.7|84/133| RP:PDB:NREP 1 RP:PDB:REP 16->83|1dpuA|7e-05|13.4|67/69| RP:PFM:NREP 1 RP:PFM:REP 15->122|PF01475|1e-12|33.3|108/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 15->123|PF01475|1.9e-20|26.6|109/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 7->136|1mzbA|3e-15|23.8|130/133|a.4.5.42| HM:SCP:REP 6->137|1mzbA_|1e-31|37.9|132/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 101 OP:NHOMOORG 82 OP:PATTERN -------------------------------------------------------------------- ---11---------11111-11--131111112222222211-1211-1111111211--223-1311211------------1---------------------------------------------------------11----------------------------------------11-11---1----------------------------1----1111-1----------------------1--------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-------1-------1---------11--1------1------------------------------1-----------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 89.5 SQ:SECSTR ###########HHHTcccccHHHHHHHHHHHHcccTTTEEHHHHHHHHcTTccHHHHHHHHHHHHHTTcEEEcccTTEEEEccEccccccEEEEEcccccEEEEcGGGGHHHHHHHHHHTccccccccccEEEccTTTc#### DISOP:02AL 1-4, 140-143| PSIPRED cccHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEccccEEEEEcccccccEEEEcccccEEEcccccHHHHHHHHHHHHccEEEEEEEEEEEEcHHHHcccc //