[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55168.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55168.1 GT:GENE BAD55168.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(341517..341849) GB:FROM 341517 GB:TO 341849 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55168.1 LENGTH 110 SQ:AASEQ MERLLVPARDEALRPGSGRRASTFTPWAGRLPLVNRPARMVGLVRVGVVTVGSGGCAASSGKSRRRCVVRPAGRSPLVDRPGRPRRRRATCHPSKRQVVRRVPPRWWLVW GT:EXON 1|1-110:0| SEG 38->66|armvglvrvgvvtvgsggcaassgksrrr| SEG 80->88|rpgrprrrr| SEG 96->109|rqvvrrvpprwwlv| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 14-17, 80-90| PSIPRED cccccccccccccccccccccccccccccccccccccHHHHHHEEEEEEEEccccccccccccccEEEEccccccccccccccccccccccccHHHHHHHHccccEEEEc //